KEGG   Drosophila ananassae: Dana_GF11941Help
Entry
Dana_GF11941      CDS       T01059                                 

Definition
GF11941 gene product from transcript GF11941-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dan  Drosophila ananassae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dana_GF11941
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dana_GF11941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 285 aa AA seqDB search
MKPQTSEQNGSAQNGDPAADAASVATEAAATIPTGGAACTTASADVAVAGAVVPVTGAKS
SQQLKLEMLNMELASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENP
DRQGLIKTPERAAKAMLFFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLV
PFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVV
EGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccaaactagtgaacaaaatggtagtgcccagaacggagaccctgccgcagat
gctgcttccgttgccactgaagcggctgctacgatccccacggggggagctgcctgcacc
actgcctccgcggatgtggcggttgccggcgccgttgttcctgtcacgggcgccaaaagc
agccagcaactcaaactggaaatgctcaacatggagctggccagcaacggaagcggccat
gagaagtgtacgttccaccacgacctggagttggatcacaagccaccgactcgggaagca
ctactgccggacatggcccgctcctaccgcctgctgttgggcggtctaggcgagaatccc
gaccgtcaaggactcatcaagacaccggagagggcagccaaggccatgctgtttttcacc
aagggctacgaccagagtctggaggatgtccttaacggcgctgtctttgacgaggatcac
gatgaaatggtcgttgtaaaagacattgaaatgttttccatgtgcgagcaccacttggtg
cctttctatggcaaggtctcgatcggctatttgccgtgcaacaagattctaggactcagt
aaactggcacgaattgtggaaatcttttcacgccgactacaagttcaggagcgtttgaca
aaacagatagcagtggcagtaactcaagctgtgcagccggcgggagtggctgtcgttgtt
gaaggagtacatatgtgcatggtgatgcgcggagttcaaaaaatcaacagcaaaactgta
acctcaaccatgctgggagtgttccgggacgatcctaagacccgcgaggagttcctcaac
ttagtcaatagcaaatag

DBGET integrated database retrieval system