KEGG   Drosophila ananassae: Dana_GF11944Help
Entry
Dana_GF11944      CDS       T01059                                 

Definition
GF11944 gene product from transcript GF11944-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dan  Drosophila ananassae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dana_GF11944
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dana_GF11944
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF11944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MGDAMNVEVKDINKLFETDGYLRPFEREIRRRHGVLQDWLNRINQGEGGLEEFSQGYKYY
GLHFQPDNTVIAREWAPGARDVYLTGDFNNWHWESHPFKKLEYGKWELVLPPNADGSPAI
KHLSEIKVIIRNHSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPASERYQRQHSR
PARPKSLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFYAASSRYGNPEQLKRMIDVAHSHGLYVLLDVVHSHASKNVQDGLNQFDGTNSCF
FHDGARGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANHLLHTLDPETITIAEDVSGMPTLCRPVSEGGIG
FDFRLGMAIPDKWIELLKEQSDDEWNMGNVVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTLSDASMIIDRGLSLHKMIRLITHSLGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDELLKYKYLNEFDRAMNELEERYGWLHSGPAYVSWKHEG
DKIIAFERAGLVFVFNFHPNRSFTGYRVGTNWAGSYQAVLSSDDPLFGGHNRIDANCKHP
SNPEGYAGRSNFIEVYTPSRTAVVYARVSD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgccatgaacgtggaggttaaggatatcaacaagctgttcgaaactgatggc
tacctgaggcccttcgagcgcgagatccgacgcagacatggagtcctccaagactggcta
aacagaatcaatcaaggcgagggcggcctggaggagttctcgcagggctacaagtactac
ggccttcacttccagccggataacacggtaatagcccgcgaatgggcgccaggtgcccga
gatgtctacctcacgggtgacttcaacaactggcattgggaatcccatccttttaagaaa
cttgaatacggaaaatgggaactggtgctgcccccgaacgcagacggtagtccggccatc
aagcacctcagcgagatcaaagtaatcattcgcaatcattccggccaactgctggatcgt
ctgtcgccatgggccaagtacgtggtccagccgccaaagtccgccaaccaaggagtcaac
tacaagcagtacgtctgggagccaccggcatcggagcggtatcagcgccagcactctcgc
ccggccaggcccaagtcgctgaggatctacgagtgtcacgtgggaatagcttcccaggag
ccacgggttggcagctacgacgaattcgccgaccgcattgtgccaagaatcaaacgccag
ggctacaattgcatccaggtaatggccataatggagcatgcctactacgccagcttcggc
taccaggtgaccagcttctatgctgcttccagtcgctacggaaacccagagcaactaaaa
cgaatgatcgacgtagcccactctcacggcctgtatgtgctgctcgatgtggtccactcg
cacgcctccaagaacgtccaggacggtctgaaccagttcgatggcaccaacagctgcttc
ttccatgatggagcccgtggcgagcactctctttgggacagtcgcttgttcaactatgtg
gagtacgaggtgctgcgattcctgctgtccaacctgcgttggtggcacgacgagtacaac
ttcgatggataccgattcgacggtgtaacctccatgctgtaccactcgcgaggcatcgga
gagggcttcagcggcgactacaacgagtacttcggtctgaatgtcgacacagatgccctc
aactatcttggactggccaaccatctgttgcacaccttggacccggagactataactatt
gcagaggacgtttctggcatgcccaccttgtgccgccccgtctcggagggtggtattggc
ttcgacttccgcctgggcatggccatcccggacaagtggattgagctgctcaaggagcaa
agcgacgacgagtggaatatgggcaatgtcgtgcatacgctcaccaatcgccgctggatg
gagaacacggtggcgtacgccgagtcccacgaccaggccctggtgggcgacaagacgatc
gccttctggctgatggacaaagagatgtacacgcacatgtccacgctgtcggacgcctcc
atgatcattgatcgaggcctgtcactgcacaagatgattcgtcttataacccactcgttg
ggaggtgaggcgtaccttaactttatgggcaacgagtttggacatcccgagtggctggac
ttcccccgagtgggtaacaacgactcgtaccactatgcacgccggcagtggaacctggtg
gacgatgagctgctgaagtacaagtacctcaatgagttcgatcgcgccatgaacgagctg
gaggagcgctacggatggctgcattccggaccggcctacgtcagctggaagcacgagggc
gacaagatcatcgcctttgagcgtgccggcctggtctttgttttcaatttccatcccaac
cgcagctttaccggctaccgtgtcggtaccaactgggctggcagctaccaggcggtgctc
tcctcggacgatccgctcttcggtggccacaaccgcatcgatgccaactgcaagcatccc
tccaatccggagggctatgccggcaggagcaacttcattgaagtttacacgccatctcgc
acagccgtggtttatgcccgcgttagcgactag

DBGET integrated database retrieval system