KEGG   Drosophila ananassae: Dana_GF12020Help
Entry
Dana_GF12020      CDS       T01059                                 

Definition
GF12020 gene product from transcript GF12020-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dana_GF12020
   01230 Biosynthesis of amino acids
    Dana_GF12020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF12020
   00030 Pentose phosphate pathway
    Dana_GF12020
   00051 Fructose and mannose metabolism
    Dana_GF12020
   00052 Galactose metabolism
    Dana_GF12020
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dana_GF12020
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dana_GF12020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 788 aa AA seqDB search
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKAYFIREGYQGM
VDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERAGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLEELVKNGTITTEQQEKFGVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVD
WPDRLCSQLAQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILGCRMGAEATLALMEATKESVPVVISLDGNQAVRVPLMECVQRTQAV
ALAMKEKRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDAEGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVARGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKSVDWLATQIKANIDANGVVNCKSPETATL
LGIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgaaattaatcaacgattcctggcgcgtggatcgcagaaggacaaaggattg
gcggtcttcaccagcggcggggattcccagggcatgaatgccgcagtgagagcctgcgtt
cgtatggccatctacctcggctgcaaggcctacttcattcgcgagggctaccagggcatg
gtcgatggcggcgactgcatccaggaggccaactgggcctcggtgtcctccattattcat
cgtggtggcaccatcattggatccgcacgttgccaggacttccgtgagcgtgccgggcgt
ctaaaggccgccaataatttgattcagcgcggtattaccaacctggtggttatcggtggt
gatggttccctaaccggagccaatctgttccgtcaggagtggtctagccttctggaggag
ttggtcaagaacggcaccatcaccaccgaacagcaggagaagttcggtgtcctgcacatt
gtgggattggtgggctcaatcgataatgatttctgcggcacggacatgaccattggaacg
gatacggctctgcacaggattattgaggctatcgatgccatttccagcactgcctactcc
catcagcgtacattcatcatggaggttatgggtcgtcattgtggttatttagctcttgtg
ggcggactggcgtgtgaggcggattttatattcattcccgaaatgccgcccaaggtcgac
tggccagacaggctctgctcccagctggcccaggagcgctcggctggccagcgtctgaac
attgtcattgtggctgagggtgccatggaccgggaaggacatcccatcaccgccgaggat
gtcaagaaggtgatcgatgaacgcctgaagcacgatgcccgtatcactgtcctgggtcat
gtgcagcgcggtggtaatcccagtgctttcgatcgtattttgggctgccgcatgggcgcc
gaggctactttggctctgatggaggccaccaaggagtccgttccagtggtcatttccctc
gatggcaaccaggccgtgcgtgtccctctgatggagtgtgtccagcgcacccaggccgtg
gcattggccatgaaggagaagcgctgggcggatgctgtcaagcttcgcggtcgctccttc
gaacgcaacctggaaacctacaagatgctgacccgtctgaagccgcccaaggagtgcttc
gatgccgagggcaagggcattgagggttatcgcctagccgtgatgcatattggtgccccg
gcctgtggcatgaacgccgccgtacgtagttttgtccgtaatgccatttatcgtggcgat
gtcgtctatggtatcaacgatggtgtggaaggtctcattgccggaaatgttcgcgagctg
ggctggtcggatgtctctggatgggtcggccaaggtggcgcctacttgggcactaaacgc
accctgcccgagggcaagttcaaggagattgccgctcgtctcaaggagttcaagatccag
ggtctactcatcattggtggctttgagagctatcatgctgccggacagattgccgatcag
cgggacaactatccgcagttctgtatccccattgtggtcataccctcgaccatttcgaat
aatgttcccggtacagagttctcgctgggctgcgataccggtctgaacgagattacggag
atctgtgaccgcattcggcaatccgctcaaggtaccaagcgtcgtgtcttcgttattgag
accatgggtggctattgcggctacttggccactctggccggcttggccggtggtgctgat
gccgcctacatttacgaggagaagttctccatcaaggacctgcaacaggatgtctatcac
atggcttctaagatggccgagggtgtggcacgtggtcttatcctccggaatgagaaggcc
agtgaaaattataccacggacttcatttaccgcctgtattcagaggagggcaagggcttg
ttcacctgccgcatgaacattctgggtcacatgcaacagggtggttcccccactcccttc
gatcgcaacatgggcaccaaaatggcagccaagtccgtggactggttggccacccagatc
aaggccaacatcgatgccaatggtgtcgttaactgcaaatcgcccgagactgccacactt
ctgggtattgtgtcgcgtcagtatcgcttctctccgttggtggatctcattgccgagact
aactttgaccaacgcatacccaagaagcagtggtggcttcgtctgcgtcccctgctgagg
atcctggccaagcatgactccgcctatgaggaggagggtatgtacatcaccgtcgaggag
gagtgcgccaccgatgccgtcgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system