KEGG   Drosophila ananassae: Dana_GF12020Help
Entry
Dana_GF12020      CDS       T01059                                 

Definition
GF12020 gene product from transcript GF12020-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dan01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dan01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dan00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dan00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dan00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dan00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 788 aa AA seqDB search
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKAYFIREGYQGM
VDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERAGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLEELVKNGTITTEQQEKFGVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVD
WPDRLCSQLAQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILGCRMGAEATLALMEATKESVPVVISLDGNQAVRVPLMECVQRTQAV
ALAMKEKRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDAEGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVARGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKSVDWLATQIKANIDANGVVNCKSPETATL
LGIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgaaattaatcaacgattcctggcgcgtggatcgcagaaggacaaaggattg
gcggtcttcaccagcggcggggattcccagggcatgaatgccgcagtgagagcctgcgtt
cgtatggccatctacctcggctgcaaggcctacttcattcgcgagggctaccagggcatg
gtcgatggcggcgactgcatccaggaggccaactgggcctcggtgtcctccattattcat
cgtggtggcaccatcattggatccgcacgttgccaggacttccgtgagcgtgccgggcgt
ctaaaggccgccaataatttgattcagcgcggtattaccaacctggtggttatcggtggt
gatggttccctaaccggagccaatctgttccgtcaggagtggtctagccttctggaggag
ttggtcaagaacggcaccatcaccaccgaacagcaggagaagttcggtgtcctgcacatt
gtgggattggtgggctcaatcgataatgatttctgcggcacggacatgaccattggaacg
gatacggctctgcacaggattattgaggctatcgatgccatttccagcactgcctactcc
catcagcgtacattcatcatggaggttatgggtcgtcattgtggttatttagctcttgtg
ggcggactggcgtgtgaggcggattttatattcattcccgaaatgccgcccaaggtcgac
tggccagacaggctctgctcccagctggcccaggagcgctcggctggccagcgtctgaac
attgtcattgtggctgagggtgccatggaccgggaaggacatcccatcaccgccgaggat
gtcaagaaggtgatcgatgaacgcctgaagcacgatgcccgtatcactgtcctgggtcat
gtgcagcgcggtggtaatcccagtgctttcgatcgtattttgggctgccgcatgggcgcc
gaggctactttggctctgatggaggccaccaaggagtccgttccagtggtcatttccctc
gatggcaaccaggccgtgcgtgtccctctgatggagtgtgtccagcgcacccaggccgtg
gcattggccatgaaggagaagcgctgggcggatgctgtcaagcttcgcggtcgctccttc
gaacgcaacctggaaacctacaagatgctgacccgtctgaagccgcccaaggagtgcttc
gatgccgagggcaagggcattgagggttatcgcctagccgtgatgcatattggtgccccg
gcctgtggcatgaacgccgccgtacgtagttttgtccgtaatgccatttatcgtggcgat
gtcgtctatggtatcaacgatggtgtggaaggtctcattgccggaaatgttcgcgagctg
ggctggtcggatgtctctggatgggtcggccaaggtggcgcctacttgggcactaaacgc
accctgcccgagggcaagttcaaggagattgccgctcgtctcaaggagttcaagatccag
ggtctactcatcattggtggctttgagagctatcatgctgccggacagattgccgatcag
cgggacaactatccgcagttctgtatccccattgtggtcataccctcgaccatttcgaat
aatgttcccggtacagagttctcgctgggctgcgataccggtctgaacgagattacggag
atctgtgaccgcattcggcaatccgctcaaggtaccaagcgtcgtgtcttcgttattgag
accatgggtggctattgcggctacttggccactctggccggcttggccggtggtgctgat
gccgcctacatttacgaggagaagttctccatcaaggacctgcaacaggatgtctatcac
atggcttctaagatggccgagggtgtggcacgtggtcttatcctccggaatgagaaggcc
agtgaaaattataccacggacttcatttaccgcctgtattcagaggagggcaagggcttg
ttcacctgccgcatgaacattctgggtcacatgcaacagggtggttcccccactcccttc
gatcgcaacatgggcaccaaaatggcagccaagtccgtggactggttggccacccagatc
aaggccaacatcgatgccaatggtgtcgttaactgcaaatcgcccgagactgccacactt
ctgggtattgtgtcgcgtcagtatcgcttctctccgttggtggatctcattgccgagact
aactttgaccaacgcatacccaagaagcagtggtggcttcgtctgcgtcccctgctgagg
atcctggccaagcatgactccgcctatgaggaggagggtatgtacatcaccgtcgaggag
gagtgcgccaccgatgccgtcgcctaa

DBGET integrated database retrieval system