KEGG   Drosophila ananassae: Dana_GF12040Help
Entry
Dana_GF12040      CDS       T01059                                 

Definition
GF12040 gene product from transcript GF12040-RA
Orthology
K05752  
chromosome 3 open reading frame 10
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 76 aa AA seqDB search
MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILER
RIDYLEACVAQGETLT
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggctcacagagaggcgatccaaaaacaaatccaccaggactgggcgaatagg
gagtacatcgaggtcataacagccagcataaagcgaataaccgactttctcaactcgttt
gatatgtcctgtcgatcacggttggccgtactaaacgaaaagctcacgatcctcgagcga
cgcatagactacttggaggcgtgcgtagcccagggcgaaacattaacgtaa

DBGET integrated database retrieval system