KEGG   Drosophila ananassae: Dana_GF12116Help
Entry
Dana_GF12116      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dan  Drosophila ananassae
Pathway
dan00040  Pentose and glucuronate interconversions
dan00053  Ascorbate and aldarate metabolism
dan00830  Retinol metabolism
dan00860  Porphyrin and chlorophyll metabolism
dan00980  Metabolism of xenobiotics by cytochrome P450
dan00982  Drug metabolism - cytochrome P450
dan00983  Drug metabolism - other enzymes
dan01100  Metabolic pathways
Module
dan_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF12116
   00053 Ascorbate and aldarate metabolism
    Dana_GF12116
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dana_GF12116
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF12116
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dana_GF12116
   00982 Drug metabolism - cytochrome P450
    Dana_GF12116
   00983 Drug metabolism - other enzymes
    Dana_GF12116
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dana_GF12116
Glycosyltransferases [BR:dan01003]
 Others
  Hydrophobic molecule
   Dana_GF12116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 6494974
NCBI-ProteinID: XP_001959302
FlyBase: FBgn0089155
UniProt: B3MBV3
Position
Unknown
AA seq 532 aa AA seqDB search
MKLRSALQILLVSLVALQQLDLGEGSRILAAFFFPGKSHFMMTNAIIRELVKRGHEVTFI
TPFSLAKENLGPNYKEIVIDQYNFWPEIKELTNTNTILEMTDLSKLTFLRMVNVMGTHST
DFAFEQPGIQAVINAKDKVGKYDLLLVEQFYNEGALILGHLYEIPVITVSTFGYANYLSQ
LFGIVSPWSYVPHLYMPYTDRMSLWDRAGNVFMSATEDLMRRYSYYPEHDAILRKHFSHL
LDRVPTINELERNISAILLNTYVPLASPRPISYNMIPVAGLHIQPPNALPENLQKFLDGA
THGAIYFSLGSQVQSADLPPEKLKIFLNVFGSLKQRVLWKFEDESLPNLPANVKVQKWMP
QADILAHPNVKVFIAHGGLFGFQEAVHYGVPVLGMPVYADQYSNLNNGKQSGLALVMDYR
KFTQEELRSNLLELLENPKFRNNMKQASKVFRDRPLSAMDTAMYWIDYVIEHRGAPHLIS
VGVELPWYQFYLLDVIGLALAVVLLPILALFCICRKSSKKTSNSPKRKIKKN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacggagtgcccttcaaatacttcttgtgagccttgtggctctccagcaactc
gatctgggcgaaggatctcgtatcctggccgccttcttctttcccggcaaaagtcacttc
atgatgaccaatgccattatccgagagctggtgaaacgaggtcatgaagtcactttcatc
actcccttctccctggctaaggagaacctgggtcccaactacaaggagatcgtaattgat
cagtacaacttctggcctgagatcaaagagctgaccaacaccaacaccattctggaaatg
acagacttgagcaaactgaccttccttcgaatggtgaacgttatgggaactcacagcacg
gactttgccttcgaacagcccggcattcaggccgttatcaacgccaaggataaggtcggg
aagtacgatctcctgctggtggaacagttctacaacgagggtgccctcattctgggtcac
ttgtatgagatcccggtcattaccgtctcaacctttggctacgccaactacctaagccaa
ctattcggcattgtctccccctggtcctacgttcctcacctatacatgccctacactgat
cgcatgtccttgtgggaccgtgctggaaacgtattcatgagtgcgaccgaggatctcatg
agaagatactcctattatcccgagcatgatgccatcctgcggaagcacttctctcaccta
ctggacagggttccgacaattaacgaacttgaaagaaatatctcggccattttactgaac
acttatgtgccattggcgtctcccagaccgatctcctacaacatgattcccgtggcagga
ctccacattcagccacccaatgctctgccagaaaatcttcagaagttcctcgatggagcc
actcacggagccatctactttagtttgggttcccaagtccaaagtgcagacttaccacca
gaaaagctcaagatattcctgaatgtcttcggcagcctcaagcagagggttttgtggaag
ttcgaggacgagtctctgcccaatcttcccgccaacgtaaaggtgcaaaagtggatgccc
caggcagacattctggcccatcccaacgtgaaagtgttcattgcccatggcggattgttt
ggcttccaggaagctgttcattacggagtgccagttctgggaatgcccgtctatgccgat
cagtattcgaacctcaataatggcaagcaatcaggcctggcgttggtcatggattacagg
aagttcactcaagaggagcttcgttcgaaccttcttgagttgctggagaacccaaagttc
agaaacaacatgaaacaggcatcgaaggtattccgggatagacctctcagcgccatggac
acggccatgtactggatagactatgtgatcgagcaccgaggagctccccatctaatttcc
gttggtgtggagcttccctggtaccagttctacctcctggacgtcattggactggccctg
gcagtagtcctactgcccatcctggcgctattttgtatctgccgaaagagctccaagaag
acgtccaacagtcctaagaggaagattaagaagaattga

DBGET integrated database retrieval system