KEGG   Drosophila ananassae: Dana_GF12150Help
Entry
Dana_GF12150      CDS       T01059                                 

Definition
GF12150 gene product from transcript GF12150-RA
Orthology
K06170  
presenilin enhancer 2
Organism
dan  Drosophila ananassae
Pathway
Notch signaling pathway
Module
Notch signaling
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dana_GF12150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 101 aa AA seqDB search
MDISKAPNPRKLQLCRTYFFAGFAFLPFVWAINVCWFFQEAFRKPPYPEQSQIKRFVIYS
AIGTLLWLLVLTAWIVIFQTNRTAWGATADYISFIIPLGSA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggacatttccaaagcaccaaaccccagaaaactgcagctctgtcggacatatttcttt
gctgggtttgccttcctgccatttgtgtgggccatcaatgtttgctggttcttccaggag
gccttccgcaagcccccatacccggaacagagccagatcaaaagatttgtaatatattcc
gcaattgggacactactttggctgctggtgctaaccgcttggattgtgatattccagacg
aatcggactgcgtggggtgccaccgcagactacattagctttattatacccctgggcagt
gcataa

DBGET integrated database retrieval system