KEGG   Drosophila ananassae: Dana_GF12283Help
Entry
Dana_GF12283      CDS       T01059                                 

Definition
GF12283 gene product from transcript GF12283-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dan  Drosophila ananassae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dan00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MSNGQYGRFGALIGVAYVSGTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWLEYDPAEI
WKLMQECIETAYKNLVILEINPQDIIAVGIVNQRGTSVLWNKNTGQPLYNAIGWSDSRST
SILKTLLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLADHVPSVKSAIQEDNCLFGTLDS
WLLWNLTGGVENGVHSTDVTNAHYTSLMNLSTEQWDSKLCQFFRLPMNILPRIRSNSEIF
GYVLEGPLLGIPISGVMGEQPACLLGQLCVKAGQNVCTLDDSCFVLLNTAKEKLDSANGL
ITGIAHKLGAKVATNYTLEGAISNSGSTINWLREKLRINTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRHDARGILLGLTSQTTSENITQ
AAYEATGFQIYEVLQAFRKDTPNWGRSCMQPVLTFGGDCAENSHLVQFIADIVGHMLERP
QTTSPAGLGAMIAAGITMDVVSLQYAAKMYAPPTDVFSPTTTQNRRELLYKRWSYAVKKC
LHWNNYETYEADVELFAQRELDPNFSVRRSIPGSLFLTTSFALLLLANYLKNNPLN
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggccagtatggaaggtttggagcactcattggcgttgcgtacgtgagcggc
acccactgccgtttcctgatttactcaaccaaaaatgccgaggtcctggcctaccatgag
ctcaagttgcggcagattgtccaccaggccgggtggctggaatatgatcccgcggagatc
tggaagctgatgcaggagtgtatcgagactgcgtacaagaatctggtgatattggaaata
aatccacaggacatcatagccgttggaatagtgaaccaaagagggacatcggtgctatgg
aataagaacacgggacagcccttgtataacgctatcggctggtccgacagccgcagcact
tccatcctgaaaaccttgctccacaatgtccggcacaatgtggactacgtgaggtatcgc
agcggattgccgttgagcagctgctttagcgctctgaaaataagatggctggcggaccat
gttccctctgttaagagtgcaatacaggaggataattgccttttcggcaccctggactcg
tggcttctgtggaatctaaccggtggagttgaaaatggcgttcattcgaccgatgtcaca
aatgcccactacacctcgcttatgaatttgtccacggagcagtgggactccaaactctgc
cagtttttcagactgcccatgaacatactgccacggattcgttccaactcggagatcttc
ggctacgttttggagggacccttgctgggcattcccatctccggagtaatgggtgaacag
cccgcttgtcttttgggtcagctctgcgttaaagctggccagaatgtatgcactttggac
gacagttgcttcgtgctgctgaacactgccaaggagaagctggactctgccaacggactg
atcacgggcattgcacacaagctgggcgcaaaagtggctaccaactataccctggagggt
gcgatttccaattccggatccaccatcaattggttgcgggagaagttgcgcattaatact
gaaataaactcaaacgacaacgtggtagagtctttgaacactttcattggcgagaactca
atgatttcgtcctcctgttcgtcttctatgctcaatgccgagtgcggattagcggcaaag
cgttcagaaatcacattcgttccggcatttcatgggttgtatgctccctattggcgtcac
gacgccagaggcatccttctcggactgaccagtcagactacgtcagagaatatcactcag
gcagcgtacgaggctactggctttcagatatacgaagtgttgcaggcatttagaaaggac
actcctaactggggtcgttcctgtatgcagccagtgctcacatttggtggtgattgtgcc
gagaactcacatcttgtccagttcattgcggacatcgttgggcatatgttggagcgccca
cagacgacttccccagccggactaggtgctatgatagccgccggtatcaccatggatgtg
gtatctctgcaatacgctgcgaaaatgtatgctccaccaacggatgtcttctctccgacc
actacacagaaccgtcgggagctactttacaagcgctggtcttatgcagtaaagaagtgc
ctgcattggaacaattacgagacttatgaggccgatgtggaactgttcgcccaacgagaa
ttagacccaaatttttctgttcgtcgttcaatacctggtagtttgttcctcaccacatcg
ttcgccctgcttcttttggccaattatctaaagaacaatccgttaaactaa

DBGET integrated database retrieval system