KEGG   Drosophila ananassae: Dana_GF12283Help
Entry
Dana_GF12283      CDS       T01059                                 

Definition
GF12283 gene product from transcript GF12283-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dan  Drosophila ananassae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dana_GF12283
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dana_GF12283
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF12283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MSNGQYGRFGALIGVAYVSGTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWLEYDPAEI
WKLMQECIETAYKNLVILEINPQDIIAVGIVNQRGTSVLWNKNTGQPLYNAIGWSDSRST
SILKTLLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLADHVPSVKSAIQEDNCLFGTLDS
WLLWNLTGGVENGVHSTDVTNAHYTSLMNLSTEQWDSKLCQFFRLPMNILPRIRSNSEIF
GYVLEGPLLGIPISGVMGEQPACLLGQLCVKAGQNVCTLDDSCFVLLNTAKEKLDSANGL
ITGIAHKLGAKVATNYTLEGAISNSGSTINWLREKLRINTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRHDARGILLGLTSQTTSENITQ
AAYEATGFQIYEVLQAFRKDTPNWGRSCMQPVLTFGGDCAENSHLVQFIADIVGHMLERP
QTTSPAGLGAMIAAGITMDVVSLQYAAKMYAPPTDVFSPTTTQNRRELLYKRWSYAVKKC
LHWNNYETYEADVELFAQRELDPNFSVRRSIPGSLFLTTSFALLLLANYLKNNPLN
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggccagtatggaaggtttggagcactcattggcgttgcgtacgtgagcggc
acccactgccgtttcctgatttactcaaccaaaaatgccgaggtcctggcctaccatgag
ctcaagttgcggcagattgtccaccaggccgggtggctggaatatgatcccgcggagatc
tggaagctgatgcaggagtgtatcgagactgcgtacaagaatctggtgatattggaaata
aatccacaggacatcatagccgttggaatagtgaaccaaagagggacatcggtgctatgg
aataagaacacgggacagcccttgtataacgctatcggctggtccgacagccgcagcact
tccatcctgaaaaccttgctccacaatgtccggcacaatgtggactacgtgaggtatcgc
agcggattgccgttgagcagctgctttagcgctctgaaaataagatggctggcggaccat
gttccctctgttaagagtgcaatacaggaggataattgccttttcggcaccctggactcg
tggcttctgtggaatctaaccggtggagttgaaaatggcgttcattcgaccgatgtcaca
aatgcccactacacctcgcttatgaatttgtccacggagcagtgggactccaaactctgc
cagtttttcagactgcccatgaacatactgccacggattcgttccaactcggagatcttc
ggctacgttttggagggacccttgctgggcattcccatctccggagtaatgggtgaacag
cccgcttgtcttttgggtcagctctgcgttaaagctggccagaatgtatgcactttggac
gacagttgcttcgtgctgctgaacactgccaaggagaagctggactctgccaacggactg
atcacgggcattgcacacaagctgggcgcaaaagtggctaccaactataccctggagggt
gcgatttccaattccggatccaccatcaattggttgcgggagaagttgcgcattaatact
gaaataaactcaaacgacaacgtggtagagtctttgaacactttcattggcgagaactca
atgatttcgtcctcctgttcgtcttctatgctcaatgccgagtgcggattagcggcaaag
cgttcagaaatcacattcgttccggcatttcatgggttgtatgctccctattggcgtcac
gacgccagaggcatccttctcggactgaccagtcagactacgtcagagaatatcactcag
gcagcgtacgaggctactggctttcagatatacgaagtgttgcaggcatttagaaaggac
actcctaactggggtcgttcctgtatgcagccagtgctcacatttggtggtgattgtgcc
gagaactcacatcttgtccagttcattgcggacatcgttgggcatatgttggagcgccca
cagacgacttccccagccggactaggtgctatgatagccgccggtatcaccatggatgtg
gtatctctgcaatacgctgcgaaaatgtatgctccaccaacggatgtcttctctccgacc
actacacagaaccgtcgggagctactttacaagcgctggtcttatgcagtaaagaagtgc
ctgcattggaacaattacgagacttatgaggccgatgtggaactgttcgcccaacgagaa
ttagacccaaatttttctgttcgtcgttcaatacctggtagtttgttcctcaccacatcg
ttcgccctgcttcttttggccaattatctaaagaacaatccgttaaactaa

DBGET integrated database retrieval system