KEGG   Drosophila ananassae: Dana_GF12404Help
Entry
Dana_GF12404      CDS       T01059                                 

Definition
GF12404 gene product from transcript GF12404-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dan  Drosophila ananassae
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dana_GF12404
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dana_GF12404
Peptidases [BR:dan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dana_GF12404
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF12404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 262 aa AA seqDB search
MRGFVILLVCLSAGSALAGTIGVSNADPFAREGRIVGGEDTTIRAHPYQVSLQKKNSNHF
CGGSIIDGYTIVTAAHCLVGQKAEKIFVRLGSTLYNEGGRLVAVRALAYNENYNSKTMEN
DVGILKLAEEVEETDDIRYIGLAEETPATGTPAVVTGWGSKCYFWCMSLPKTLQEVIVSI
VDWGRCASEEYKYGEIIYPSMVCGYEKKKDACQGDSGGPLVAENVLVGIVSWGYACASNL
LPGVYSDVAALRKWILSTSETL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggggctttgtaattcttctggtctgcctgtccgctggttctgccttggctggaacc
attggcgtgtccaatgccgatcccttcgcccgcgagggtcgcattgtgggcggcgaggat
accaccataagggcccatccctaccaggtttccctgcagaaaaaaaactctaaccatttc
tgcggcggcagcatcattgacggctacaccattgtgacggctgcccattgtttggtgggc
cagaaggccgagaagatctttgtgcgcctgggctccactctctacaatgaaggcggccgg
ctggtggctgtccgggctttggcctacaacgagaactacaactccaagactatggagaac
gatgtcggcattctaaagctggccgaggaggtcgaggagactgatgacattcggtatatt
ggtttggctgaggagactccggcaacgggaacgcccgcagtggtcactggatggggatcc
aagtgctacttctggtgcatgtcactgcccaaaaccttgcaggaggtcatcgtcagcatc
gtggattgggggagatgcgcttcggaggaatataaatacggtgaaatcatatacccctcc
atggtttgcggctacgagaaaaagaaggacgcctgtcagggagactccggcggtcctttg
gtggccgagaacgtgctggtgggcattgtgtcgtggggctatgcctgcgcttcgaatctc
ctgcctggagtctacagcgatgtggctgctttgcgtaaatggattctttctacatccgaa
actttgtaa

DBGET integrated database retrieval system