KEGG   Drosophila ananassae: Dana_GF12404Help
Entry
Dana_GF12404      CDS       T01059                                 

Definition
GF12404 gene product from transcript GF12404-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dan  Drosophila ananassae
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dan04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 262 aa AA seqDB search
MRGFVILLVCLSAGSALAGTIGVSNADPFAREGRIVGGEDTTIRAHPYQVSLQKKNSNHF
CGGSIIDGYTIVTAAHCLVGQKAEKIFVRLGSTLYNEGGRLVAVRALAYNENYNSKTMEN
DVGILKLAEEVEETDDIRYIGLAEETPATGTPAVVTGWGSKCYFWCMSLPKTLQEVIVSI
VDWGRCASEEYKYGEIIYPSMVCGYEKKKDACQGDSGGPLVAENVLVGIVSWGYACASNL
LPGVYSDVAALRKWILSTSETL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggggctttgtaattcttctggtctgcctgtccgctggttctgccttggctggaacc
attggcgtgtccaatgccgatcccttcgcccgcgagggtcgcattgtgggcggcgaggat
accaccataagggcccatccctaccaggtttccctgcagaaaaaaaactctaaccatttc
tgcggcggcagcatcattgacggctacaccattgtgacggctgcccattgtttggtgggc
cagaaggccgagaagatctttgtgcgcctgggctccactctctacaatgaaggcggccgg
ctggtggctgtccgggctttggcctacaacgagaactacaactccaagactatggagaac
gatgtcggcattctaaagctggccgaggaggtcgaggagactgatgacattcggtatatt
ggtttggctgaggagactccggcaacgggaacgcccgcagtggtcactggatggggatcc
aagtgctacttctggtgcatgtcactgcccaaaaccttgcaggaggtcatcgtcagcatc
gtggattgggggagatgcgcttcggaggaatataaatacggtgaaatcatatacccctcc
atggtttgcggctacgagaaaaagaaggacgcctgtcagggagactccggcggtcctttg
gtggccgagaacgtgctggtgggcattgtgtcgtggggctatgcctgcgcttcgaatctc
ctgcctggagtctacagcgatgtggctgctttgcgtaaatggattctttctacatccgaa
actttgtaa

DBGET integrated database retrieval system