KEGG   Drosophila ananassae: Dana_GF12448Help
Entry
Dana_GF12448      CDS       T01059                                 

Definition
(RefSeq) GF12448 gene product from transcript GF12448-RB (EC:3.2.1.52)
  KO
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dan  Drosophila ananassae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF12448
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dana_GF12448
   00603 Glycosphingolipid biosynthesis - globo series
    Dana_GF12448
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dana_GF12448
   00511 Other glycan degradation
    Dana_GF12448
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF12448
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dana_GF12448
Chaperones and folding catalysts [BR:dan03110]
 Intramolecular chaperones
  Others
   Dana_GF12448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 687 aa AA seqDB search
MLPLRRLWSLQFPCVCQSLRYLYKMSLAVSLRRALLALLSGAIFILTVLYWNQGTIKTQA
YNEALERHPSHRDASAFPIPVEKSWTYKCENDRCMRVGHHGKSGKRVSFISCSMTCGDIN
IWPHPTHKHVLSPHTHSFSVDDVQLQVDTTHREVRKQLQTVFDWFLKDLRQIQRLDYAGS
GSEPAVSESSSSKSRRHTQQDSEPAATLFGATFGAKQAGDLSSVQVKIAVHKSGDLNFSL
DNDESYYLTSNTDGHRLLVEITANSYFGARHGLSTLQQLIWFDDEDRLLHTYASSKVKDA
PKFRYRGLMLDTSRHFFSVEAIKRTIMAMGLAKLNRFHWHLTDAQSFPYISRYYPELAEH
GAYSESETYTEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQ
PWSFYCGEPPCGQLNPKNNHTYLILQRLYEELLQQTGPTDLFHLGGDEVNLDCWAQYFND
TDLRGMWCDFMLQAMARLKVANNGVAPKHVAVWSSALTNTKCLPNSQFAVQVWGGSTWQE
NYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGEAACAPYRTWQNVYKHRPWERMRLDKRR
KKQVLGGEVCMWTEQVDENQLDNRLWPRSAALAERLWTDPSDDHDMDVVPPEVFRRISLF
RNRLVELGIRAEALFPKYCAQNPGECI
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcttccattgaggcgcctgtggagcctccaattcccttgcgtgtgccaaagcctacgt
tatctgtataagatgtccctggcggtctcgttgcgacgagctcttctggcgctactctcc
ggagccatcttcatcctgacggtgctctactggaaccagggaaccatcaaaactcaggcc
tacaatgaggccctagaacgccaccccagccatcgggatgccagtgcctttcccataccc
gtcgagaagtcctggacgtacaagtgcgagaatgaccgatgcatgcgagtgggccaccac
ggcaagtccggcaagcgcgtctcgttcatcagttgctccatgacgtgcggcgacattaac
atctggccccatcccacccacaaacatgtgcttagtccgcacacgcacagcttctccgtg
gacgatgtgcaactgcaggtggacactactcatcgggaggtccgcaagcagctgcaaact
gtctttgactggtttctgaaggatctgcgacagattcagcggctggactatgccgggagt
ggttcagagcccgcggtcagcgaatcctcgtcatcgaaatcccgacgtcacacccaacag
gactcggaaccagcagccacgctattcggcgccaccttcggggcaaagcaggccggagat
ttgtccagcgttcaggtcaagatcgccgtacacaagtcgggagacctcaactttagtctc
gacaacgatgagagctactacctaacatcgaataccgatgggcaccgtttgctggtggaa
atcactgcgaattcgtacttcggggcccgtcatggcctttccacgctgcagcaactaatc
tggtttgatgacgaggatagacttctgcacacctatgccagcagcaaggttaaggatgcc
cccaagttccggtaccgcggcttgatgctggacacatcgcggcacttcttctccgtggag
gccatcaagcggacgatcatggccatgggcctggccaagctgaaccgattccactggcat
ctaactgatgcccagagttttccctacatttcgcggtactatcccgagctggccgagcac
ggagcctactcggagagcgagacttacacagagcaggatgtgcgggaagtggcggagttt
gccaagatatatggagtgcaggtgattccggaaatcgatgctccagcccatgcgggcaat
ggctgggattggggacctaaacgcggcatgggtgagctggcgatgtgtattaaccagcag
ccctggagcttctactgcggcgagccgccttgcggtcagctgaatccgaagaacaaccac
acctacctcattctgcagcgcctgtacgaggagctgctgcagcagacgggacccacggac
ctcttccacctgggtggcgatgaggtgaaccttgattgctgggcgcagtattttaatgac
acggatctgcgcggcatgtggtgcgactttatgctccaggcaatggccagactaaaagtg
gccaacaatggagtggcgcccaagcatgtggcagtctggtcgagtgccctcaccaacacc
aagtgtcttccaaacagtcaattcgccgtacaggtctggggcggcagcacctggcaggag
aactacgacctgctcgataacggctataatgtgatcttctcgcacgtggacgcttggtac
ttggactgcggctttggcagttggcgggccactggcgaagctgcctgtgctccctaccgc
acctggcaaaatgtctacaagcaccgcccgtgggagcggatgcgattggacaaaaggcgc
aagaagcaggtgttgggtggtgaggtgtgcatgtggaccgaacaggtggacgaaaatcag
ctggataaccggctgtggcccagatctgctgccttagctgaacgcctctggacggatccc
agtgacgatcatgacatggatgttgtgccgccggaagtgttccgcagaatctcattgttc
cgaaaccgccttgtcgagcttgggattagggctgaagccctgtttcccaaatactgtgcc
cagaatcccggggaatgcatttga

DBGET integrated database retrieval system