KEGG   Drosophila ananassae: Dana_GF12451Help
Entry
Dana_GF12451      CDS       T01059                                 

Definition
GF12451 gene product from transcript GF12451-RA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dana_GF12451
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF12451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 850 aa AA seqDB search
MAVKQNNTESGDGSENAGNNNSGLPPNSKPTAVNGLKMSNESGAAAGMDLGSSTNEGGLN
TNRPGKRDIKSLLQCLEQPEQAHNLMGFYEHIIVELSRMQHSKTPEDIARFKEEATKVGA
FLAKRNEKHYQMFYLRVVYDLITKSSFDPPPSCALAIVFQLFDSNQILEAVHSLLEQNVQ
DASIRKTVGLLCVWMGECTFCSNLSLWVMALLNGLKDQGKRALLDEIALDNIEKLFSLMI
FPAIRHKASPLVFHMLSTINQTPEVFHKILPKIPLVLQYLKQQANSNEDAGLEARKCLQQ
LVDLTSALVLRFYDHDDLYANVKKALQTYDPSPNCLALARAMQESAQPWGRRNARVGLVN
LGNTCYMNSVLQALAMTSDFSRQILLIECDSVLLRKVQQQIALMHHSLRYELTPLVVLNA
TRPPGFTPGLQQDSSEFLGHLLDLLHEHEINSFTKSGRNGGRAPMANNSEVICLLNEEIE
TSGVIPYNRNDRDLGIGGSKANPTPTPPATPTKNPSSSHQQQQQHCEPELTPPKPSSTID
KTFAGKLSTTYRCLSCGWESRNEDSFRELQLSFPDDKDDCGATNYSVQDLIEYYCSPEKL
DGDNQYFCPRCKKLCDAERHIGVTQPPRNLILTLKQFKYDQKYHFRTKLMHKVFHDESVT
VKVCTMESLQEMSTVHYDLYAGVVHAGYSMDSGHYFTFAADQSKRWYKFNDNLVTHSQPE
EMHNLTSPNTPYILFYKMCARSNECNEASTSSLSGIGSGHQVISVPESPPLSLEELPSQL
RDYVKKDNRVYNEELRIQRYKRGGGSLGGNGFVSRHNYDGDGDDEDDQAPPPTGGCGGNG
LGMSFNRFVY
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagcagaataacaccgaatcgggtgacggttccgagaatgccggcaataac
aacagcggtctgccgcccaactcaaagcccactgccgtcaatggactgaagatgtccaat
gaaagtggtgcggctgctggtatggatctgggatcttccaccaacgaaggtggactgaat
accaatcggcctggcaagcgtgacattaagagtttgctgcagtgcctggaacaaccggaa
caagctcacaacttgatgggcttttacgagcatattattgtcgaactgtcgcgcatgcaa
cattcaaagacgccagaggacatcgcccgcttcaaggaggaggccacaaaggtcggtgct
tttctcgccaagcgcaacgagaagcactatcagatgttctacctgcgagtcgtctacgat
ctgatcaccaagtcctccttcgacccgccaccgtcgtgtgcgctggcaattgtgttccaa
ttgttcgattcgaatcagatactcgaggcggtgcactcattgctggaacagaacgtgcag
gacgcgagcatccggaagacagtgggcctgctgtgcgtttggatgggcgagtgcaccttc
tgcagcaacctatcgctttgggtgatggccctgctcaacgggctgaaggatcaaggcaaa
cgggcgctgctggacgagattgcgctggacaacatcgagaaactcttcagtttgatgatc
ttccccgcgattcgccataaggcgtcacctttggtgttccacatgctgtccaccatcaac
caaacgcccgaggttttccataagattttgccaaagatcccacttgtgctgcagtatctg
aagcagcaggcgaattccaacgaagatgctggcctggaggctcgtaaatgtctccagcag
ctggtcgacctaacgagcgctctggtgcttcgcttctacgaccacgatgacctttacgct
aatgtgaaaaaagcactgcagacgtacgatccctcgcccaattgcctggctttggcgcga
gcgatgcaggagagcgcccagccctggggacgaaggaatgcgagagttggactagttaac
ctgggcaacacttgctatatgaacagcgtgctgcaagcccttgccatgactagcgatttc
agccggcagatcctactcatcgagtgtgactcagttttgctaagaaaggtgcagcagcaa
atcgccctgatgcatcactcgctgcgttatgagctaacacctttggtagtcctaaatgcc
actcggccgccaggattcacgcccggtctgcagcaggatagctccgagttcctaggccat
ttgctggacttgctgcacgagcacgaaatcaacagtttcacaaagtctgggcgcaatgga
ggacgagctccaatggccaacaactcggaggtgatttgcttgcttaacgaggagattgaa
accagcggtgtgataccctataataggaatgatcgggatctaggcatcggcggaagcaag
gccaatcccactcccacaccacctgcaacacccaccaaaaacccaagcagctcgcaccag
cagcagcagcagcattgcgagccagaattgacgccacccaaaccgtcatccaccattgac
aagacgttcgcggggaagctatcgaccacctatcgatgtctgagctgcggctgggagagc
cggaatgaagacagcttccgcgagcttcagctatcatttcccgacgacaaggacgactgc
ggagcaaccaactattcggtgcaggatctaatcgagtattattgctcgcctgagaaactt
gacggggataaccagtacttttgtccgcgctgcaaaaagctctgcgatgcggagcgccac
atcggcgtcactcaacctccccggaacctcatccttacgctgaagcagtttaaatacgat
cagaagtaccatttccgcaccaagcttatgcacaaggtgttccacgatgagagcgtcaca
gtgaaggtgtgcaccatggaatccctgcaggaaatgtcgacagtacattacgacctttat
gctggtgttgtgcatgcgggttatagcatggactccgggcactatttcacatttgccgct
gatcaatcgaagcgttggtacaagttcaacgataacctggtgacccactcccagccggag
gaaatgcacaacctcacctcgccgaacacaccatacattttgttctacaaaatgtgcgca
cgctccaacgaatgcaatgaggcgtctaccagctcattgtcagggataggatcgggtcac
caagtgatttcggtcccggaatcaccgcctttgtcgctggaggagttgccaagccagctg
cgcgattacgtgaagaaggacaaccgcgtttacaacgaggagttaagaattcagcgctac
aaacgcggcggcggtagcctcggtggaaatggttttgtcagtcggcacaattacgatggc
gacggggacgatgaggatgaccaagcgccgccaccgaccggaggatgcggtggcaatggg
ctgggtatgagcttcaatcgattcgtatactaa

DBGET integrated database retrieval system