KEGG   Drosophila ananassae: Dana_GF12464Help
Entry
Dana_GF12464      CDS       T01059                                 

Definition
GF12464 gene product from transcript GF12464-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dana_GF12464
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dana_GF12464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 423 aa AA seqDB search
MRLFPVRLSAASSSMTSLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSFIFLRKELPV
RLANIMKEIALLPDNLLHTRSVTEVSGWYVKSFEDVLEYEKAEPTHDNLQKFVQDLDLIR
NRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGG
NPHSGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEIQQHSSEPADNLPIRT
VYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIP
RSQTDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTD
AIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLSASTPKRYSDFV
QDA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgttcccagtccggctctcggccgcctcctcgtcgatgacgagcctggccaaa
atgctcgatttctactcgggcttcaatccatcgcctctgtcgataaaacagttcatggac
tttggtcaaaatgcctgcgaaaagaaatcctttatattcctgcgaaaagagctacccgtt
cgactggcgaacatcatgaaggagatcgccctcctccctgacaaccttctccacacaaga
tcggtgaccgaggtgagtggctggtatgtgaagagcttcgaggatgttctggagtacgag
aaagcagaacccacacacgacaatcttcaaaaatttgtgcaagatttggatctcatcagg
aatcgtcacaacgatgtggtgcaaaccatggcccagggtgtcatcgagatgaaggagaac
gagggcggccaggtggatgcacccaccgagagctccatccagtactttctcgaccgcctc
tacatgtcccgcatcagcatccgaatgctgatcaaccagcacaccctactctttggcggc
aatccccattcgggtggtcgtcatatcggctgtttggatcccgcctgcgatctgtcggac
gtggtgcgagatgcctacgagaatgctcgattcctgtgcgatcagtactacctgaccagt
ccggcgctggagatccagcagcacagcagcgagccagcggacaaccttcccatccgcacc
gtttacgtgccctcgcatctatattacatgctcttcgaactcttcaagaactcaatgcga
gcggtggtggagcatcatggccatgacaataatgacacgctgccgccgctgaaggtggcc
atctgcaagggcaaggaggacatctgcgtgaagatctcagaccagggaggcggcattccc
cgctcccagacggaccaactattcaagtacatgtacagcacagctccccagccctccaag
tcggatctgcatacggttcctttggcgggttatggctacggcctgccgatctctcgactc
tatgctcggtatttccacggagatattgtgctgctttcctgtgagggattcggaacagat
gctatcatatacctgaaggctctgtccgatgaggccaacgaactgttgcccattttcaac
aagacaagctcaaagttctatcgcgccaccgtgcccacgggcgactggtccaatcagagc
tcggatatgaatgcccggcagctgtcggccagcactccgaaacgctacagcgactttgtc
caggacgcctaa

DBGET integrated database retrieval system