KEGG   Drosophila ananassae: Dana_GF12581Help
Entry
Dana_GF12581      CDS       T01059                                 

Gene name
Dana_Amyc1
Definition
alpha-Amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dan  Drosophila ananassae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dana_GF12581 (Dana_Amyc1)
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dana_GF12581 (Dana_Amyc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 494 aa AA seqDB search
MLLAKSFVCLTLFVLAKAQFNPNYVAGRSGIVHLFEWKWNDIATECENFLAPKGYAGVQV
SPVNENAVKERRPWWERYQPISYQLMTRSGNEEQFARMVRRCNNVGVRIYVDVVFNHMAA
DGGTVGTGGSIANPSVKSYPAVPYSNPDFHPTCAINNYNDAAQVRNCELVGLHDLNQGNS
YVRDKVVLFLNHLIDLGVAGFRVDAAKHMWPADLGVIYSRLKNLNPSHGFVQGSKAFIIQ
EVIDMGGEAISKFEYTSLGLVTEFRHSNSIGKVFGGKDQLRWLTNWGTEWAFAPSNCSLV
FVDNHDNQRGHGPGGEDVLTYKLSKQYKMANAFMLAHPFGTPRIMSSFAFENTDQGPPTV
DGQTIASPTFNSDDSCGGGWICEHRWRQIYNMVAFRNSVGLDPVQNWWDNGNNQIAFSRG
NKGFVAFNNDNSDLNQSLKTELPKGSYCDVISGAKKGSVCTGKTVVIESNGMARININRS
EYDGVLAIHINAKL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggccaagagttttgtgtgccttaccctttttgtgttggccaaggcccagttc
aacccaaattatgtggcaggccgcagcggcatagtccatctttttgaatggaaatggaat
gacattgccacagagtgtgaaaactttctggcaccgaagggatacgcaggtgtccaggtc
tcgccggttaatgaaaatgctgtgaaagagagacgtccctggtgggagcgttaccaaccc
atatcctaccagttgatgactcgttctggtaatgaagagcagtttgccaggatggtccgg
cgatgtaataatgtcggagttcgcatctacgtggatgtggtttttaatcacatggcagcc
gatggtgggactgttggcacaggaggaagtattgcaaatcccagcgtcaaaagttatcct
gcagttccgtattccaacccggactttcatcctacctgtgccattaacaattacaatgat
gccgcccaggtgcgcaactgcgagctggttggcttgcatgacttgaaccaagggaactcg
tatgtccgggataaagttgtcctgtttttgaaccatttgattgaccttggtgtggctgga
ttccgggtggatgccgccaagcacatgtggcccgctgaccttggtgtgatctacagtcgc
cttaagaatctcaatccatcacatggttttgtccagggttctaaagctttcattatccag
gaagttattgatatgggcggtgaggctatcagtaagttcgaatacactagcctgggcttg
gtcactgagttccggcactccaactccattgggaaggtatttggtggcaaagaccagctg
agatggttgaccaactggggcactgaatgggcttttgctccctcgaactgctccttggta
tttgtagacaaccatgataaccaacgtggacacggaccaggtggtgaagatgtgctcacc
tataagctatccaagcagtacaagatggcaaatgccttcatgctggcccaccctttcggc
actcctcgcatcatgtcttcctttgccttcgaaaatacggatcagggtccacccactgtc
gatggtcagaccattgccagtcccacttttaacagtgacgactcgtgcggaggcggttgg
atttgcgagcaccgctggcgccagatctataacatggtggccttccgaaactccgttgga
ttggatcctgtccagaactggtgggataacggcaacaatcagattgcctttagcagggga
aacaagggctttgtggcattcaacaacgacaactccgacctgaaccaatctttgaagaca
gaacttcctaagggttcctactgtgatgtaatctccggcgcaaagaagggatctgtctgc
actggcaagactgtagtcatcgaatctaatggaatggccagaattaatataaatcgatcg
gagtacgatggggtcctcgctattcatattaatgctaagttgtag

DBGET integrated database retrieval system