KEGG   Drosophila ananassae: Dana_GF12763Help
Entry
Dana_GF12763      CDS       T01059                                 

Definition
GF12763 gene product from transcript GF12763-RA
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 470 aa AA seqDB search
MNMTGGGAGPQAGPNSSCNIPNSSLLATAPVAATMPIAQLADGWLELESDPGLFTLLLED
FGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSIFF
AQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKAHTKGMSPENKGLAIGNTPELACA
HNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGWED
HEDWTDKFRRVMTERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTLQK
LLKADEQGEGGNGDPQRPDTPSTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADENDRR
HKFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQHLLPSKKISGQSAANRLNKQSNA
TANAGATAAGAAGAAPKSQQQQAAAAKNGKSPSKTPGRRRKGRNKCKKRK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgactggaggcggcgcaggtccccaggcgggaccgaacagcagctgcaatatc
cccaatagttccctccttgctaccgctccagtagctgccacaatgccgattgcacaactg
gcagacggctggctagaactggaatcagatcctggtctcttcacccttctcctagaggac
tttggctgtcatgatgtacaggtggaggaagtatacgatctccagaaacccatcgagagc
ccctatgggtttattttcctttttcgctggatcgaagagaggcgagctcgacggaaaata
gtcgaaactacagcggagattttcgtcaaggacgaggaggccatttcaagcatcttcttt
gcccagcaggtggtgcctaatagctgcgccactcacgccctgctttctgttctgctgaac
tgcaacgaaaacaatctacagttgggggacactctcagtcgtcttaaggcgcacaccaag
ggcatgagtccagagaacaagggactggccattggcaacaccccagaactggcctgtgcc
cacaattcacacgccatgccgcaagccagacgccgtctagagcgtactggagctggtgtc
tccagctgccgcttcaccggtgaggcgtttcactttgttagttttgtgcccatcaacgga
cagctgtttgagctggatggcttgaaaccatatccgatgaatcacggcggctgggaggat
cacgaggactggactgacaagtttcgacgagtgatgacagagagactaggcatcgccacc
ggggagcaagatatccgattcaaccttatggctgtggttcccgacaggcgtatcgccata
actcacaagttgaagatgctgcgcaccaatcaggccatcgtttcgggcactttgcagaag
ctgctgaaggcggacgagcaaggagaaggaggaaatggagatccccagcgacctgacacg
cccagtacactcctagaaccgagtgcgttcacggcacgggatctgcagtctctgctaaag
aatttggacactgagattgccataaatgagcagcacctggccgatgaaaacgaccggcgg
cacaagttcaaggtggacgcaagccgtcggacacataactacgataagttcatttgtact
ttcctctccatgctggcccatcagggagtcctgggcgagctggtcagccagcacctgctg
ccctcgaaaaagatcagtggccagagtgcagccaaccgattaaataagcagagcaatgcc
actgccaatgcgggtgccacggctgcaggagcagctggggcagcgccaaagagccagcag
caacaggcagccgccgctaagaatgggaaatctcccagcaaaactccgggcaggaggcga
aagggtcgcaacaagtgcaagaagagaaagtaa

DBGET integrated database retrieval system