KEGG   Drosophila ananassae: Dana_GF12811Help
Entry
Dana_GF12811      CDS       T01059                                 

Definition
GF12811 gene product from transcript GF12811-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dan  Drosophila ananassae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dana_GF12811
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dana_GF12811
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Dana_GF12811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1641 aa AA seqDB search
MLSEGFHWFWRSVLQILMRYQFFRWLLGFIEPDKNAPLQIESEEEQLPGMKKKQEQQKQQ
QHRPPAEISESVVIRTGASAMGNAGSAEIVSNQIIRRPEISTMGKETDSHSIPINEGQNA
EHVLYRLKRGAKLSVHPDAALLGRKILLYTNYPAEGQKFVRTEYRLLNWHLSSGKQISSV
MHPEAHVVDTDIYSQLELNLSGTFHFYFRYLERPDTGASGADGALYVQVEPTLHVGPPGA
QKTIPLDSVRCQTVLTKLLGPLNTWEPKLRVAKEAGYNVIHFTPIQELGGSRSCYSLRDQ
LKVNSHFANQKGGKVTFEELEKVIKKCRQEWGVASICDIVLNHTANESEWLIQHPDATYS
CATCPYLRPAFLLDAAFAACGADIAEGGLEHVGVPQVIDQECHLEALKYQLHTSYLSRVN
IHELYQCDVMKYVNDFMTQVRTREPPKNVANESRFQEIQLIQDPEYRRLASTINFELALE
IFNAFHGDCFDEESRFRKCAETLRRHLDSLNDRIRAEVQGYLNYAVDNVLAGVRYERVQG
DGPKVREISEKHSVFMVYFTHTGTEGKSLTEIEADMYTQAGQFFMAHNGWVMGSSDPLRD
FAEEQEGRANVYLKRELISWGDSVKLRFGRKPEDSPYLWKHMTEYVETTARIFDGVRLDN
CHSTPLHVAEFLLDAARKINPELYVVAELFTNSDATDNVFVNRLGITSLIREALSAWDSH
EQGRLVYRYGGVPVGGFYANSARHEASSVAHALFLDLTHDNPSPVEKRSVYDLLPSAGLV
SMACCATGSNRGYDELVPHHIHVVDEERLYQEWGKGVDSKSGIMGAKRALNILHGQLAEE
GFSQVYVDQMDPNVVAVTRHSPTTHQSVILVAHTAFGYPNPNAGATGIRPLRFEGVLDEI
ILEASLTMQGDKPFDRPAPFKKDPNVINGFTQFQLSLQEHIPLAKSTVFETQAYVDGSNT
VLNFANLRPGTVVAIRVSVHPGPRASFDKLQKLTNALRRGTGEEYSQLQDIVSKLDFVAL
SGALFNCDQEERDMGNGGSAYDIPNFGRIVYCGLQGFVSLLTEISPKNDLGHPLCNNLRD
GNWMMDYIADRLTSFEDLKPLSAWLKATFEPLKNIPRYLIPCYFDAIVSGVYNVLINQVN
ELMPDFIKNGHSFTQSLALSTLQFLSVCKSANLPGFSHAISPPKPPKQCVTLSAGLPHFS
TGYMRCWGRDTFIALRGSMFLTGRYNEARYIIIGFGQTLRHGLIPNLLDGGSRPRFNCRD
AVWWWMYCIKQYVEDAPKGIEILKDKVSRIFPYDDAEAHAPGAFDQLLYDVMQEALQVHF
QGLQYRERNAGREIDEHMVDQGFNNHIGVHPETGFVYGGNNFNCGTWMDKMGSSQKAGNK
GRPSTPRDGSAVELIGLQYASLRFMQSLAEKDIIPYSGVERKGPSGEKTKWTYKEWADRI
KDNFDKFFFVSESETGSLANKKLIYKDSYGATQSWTDYQLRCNFPITLTVAPELCNPQNA
WRALEQARKYIQGPLGMKTLDPEDWNYRANYDNSNDSTDCTVAHGANYHQGPEWVWPIGF
YLRARLIFAKKCGHLDETIAETWSILRNHLREMQTSHWRGLPELTNDNGAYCGDSCRTQA
WSVAAILEVLYDLHSLGADVA
NT seq 4926 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctgagggattccattggttctggaggagtgtcctccagatcttgatgcgttat
cagttctttcgctggctgctgggattcatagagcctgataagaatgcaccgttacaaatc
gaatcagaggaagagcaactaccgggaatgaagaagaagcaggagcagcagaagcagcag
cagcatcgcccgccggctgagatctcagaatcagtcgtgattagaaccggtgcaagtgca
atgggaaatgcagggagtgccgagatcgtatcaaatcaaatcatccgtcgcccggagatc
agcaccatgggcaaggagacggattcgcacagcatccccatcaacgagggtcagaatgcg
gagcatgtcctctaccgtctgaagaggggcgccaagctcagtgtccatccagatgccgcc
ctcctgggccggaagatactactctacaccaactatcccgccgagggtcagaagttcgtt
cgaacggagtaccggctcctcaactggcacctcagcagtggcaagcaaatctcatccgtg
atgcatccagaggcgcatgtcgtggacacggatatatacagccagttggagttgaacctc
tcgggcactttccacttctacttccggtatttggagagaccagacactggagcttctgga
gctgatggtgctctatacgttcaagtggaacccacactgcatgtaggaccgccaggagcc
cagaagaccatccccctggactcggtgcgctgtcaaacagtattgaccaagctcctgggg
ccactcaacacctgggaacccaaactgcgcgtggccaaagaggccggatacaatgtgatt
cacttcacccccattcaggagctgggaggctcacggtcctgctactccctgcgtgaccag
ctcaaggtcaactcccactttgccaaccagaagggaggaaaggtcaccttcgaggagttg
gagaaggtcatcaagaagtgccgtcaggagtggggagttgcctccatctgcgacattgtg
ctgaatcacacggccaacgagtccgagtggctgatccagcatcccgacgccacgtactct
tgtgccacgtgcccgtatctccggcctgccttcctgctggacgccgcctttgccgcctgc
ggagccgacatagccgagggtggtctggagcacgtgggagtaccgcaggtcatcgatcag
gagtgccatttggaagccttaaagtaccagctgcacacctcctacctgtccagggtcaat
attcacgagctgtaccagtgcgatgtgatgaagtacgtcaacgacttcatgacccaggtg
cgcactcgggagccacccaagaacgtggccaacgagtcgcgcttccaggagatacaactg
atacaggacccggaatatcgacgcctggccagcaccattaattttgagctggcactggag
atctttaatgctttccatggcgactgtttcgatgaggagtcgcggttccgcaagtgcgcc
gaaacccttcgccggcatctggattctttgaacgatcgcatccgcgccgaagtccaggga
tacctgaactatgccgtagacaatgttttggccggagtgcgctacgaacgcgtccagggc
gatggtcccaaggtgcgagagatctcggagaagcattcggtcttcatggtctacttcaca
cacacgggcaccgaaggcaagagcctgaccgagatcgaggcggacatgtacacccaggcg
ggacagttcttcatggcccacaacggctgggtgatgggctccagtgatccactccgggac
tttgccgaggagcaggagggtcgtgctaatgtctaccttaagcgcgagctcatctcgtgg
ggcgacagcgtcaaactgcgctttggtcggaagccggaggacagcccgtacctgtggaaa
cacatgaccgagtatgtggagaccactgcccgcatcttcgatggtgtccgcctggacaat
tgccactctacgccgctgcacgtggccgagtttctgctggacgccgcccggaagatcaat
ccggagctgtatgtggtagctgagctgttcaccaactccgatgccaccgacaatgtgttt
gtgaaccgtttgggaatcacctccctgatccgcgaggctctctccgcctgggactcccat
gagcagggacgtctggtttatcggtacggcggcgtgccagtgggtggcttctatgccaac
tccgcccgccatgaagcctccagcgtggcacacgccctgttcttggacctgacccacgac
aacccgtcgccggtggagaagcgttccgtttacgatctgctgccctcagcaggattagtt
tccatggcatgctgtgccactggcagcaaccgtggctacgatgaactggtgcctcatcat
atacacgtggtggatgaggagcgcctttaccaagaatggggaaagggcgtggactccaag
tctggcatcatgggcgccaagcgggctctgaatatcttgcacggccaactggcggaggag
ggtttcagccaggtgtacgtcgatcagatggatcccaatgtcgtagccgtcacccgccac
tccccaaccacccaccagtcggttattttggtggcccacaccgccttcggttatccgaat
cccaatgctggagccactggtatccggccgctgcgattcgaaggcgttctggacgagatc
atcctcgaggccagcctgaccatgcagggtgacaagccattcgatcgcccagctcctttc
aagaaagacccgaacgtaatcaacggcttcacgcagttccagctcagtctccaggagcac
ataccgctggccaagtccactgttttcgagacccaggcctatgtggacggaagcaacacc
gtgctgaacttcgccaacctgcgacccggcactgtggtggccatcagggtgtcagtgcac
ccaggaccccgggccagcttcgataaactgcagaagctcacgaacgcactgcgccgggga
accggtgaggagtactcccaactgcaggacatcgtatccaagctggactttgtggcgctg
agcggtgctctcttcaactgcgaccaggaggaacgggacatgggcaacgggggatcggcc
tatgatattcccaactttggccggattgtgtactgtggcctgcagggattcgtgtccctg
ctgacggagatttcgcctaagaacgatttgggtcacccactgtgcaataatctacgcgac
ggaaactggatgatggattacatcgccgaccggctaaccagtttcgaggacctgaagccg
ctctccgcgtggttgaaggccacctttgaacccctgaagaacatccctcgctacctcata
ccctgctactttgatgccatcgtcagtggggtctacaacgtgctcatcaatcaagtcaac
gaactcatgccagatttcataaagaacgggcatagcttcacccaatcactggctctctcc
acgctgcagttcctctcggtctgcaagtcagccaacctgccagggttcagccatgccata
agcccaccgaaaccccccaagcagtgtgtcactctttccgccggactgccgcatttctca
actggctacatgcgctgctggggccgtgacaccttcatcgccctgcgtggctccatgttc
ctaactggtcgctacaacgaagcccgctacataatcattggattcgggcagaccttgcgt
catggtctgatccccaatctcttggatggtggcagcaggcctagattcaactgccgcgac
gccgtctggtggtggatgtactgcatcaagcagtacgtggaagatgcccccaaaggaatc
gagatcttgaaggacaaggtgtcgcgcatcttcccctacgacgatgcggaggcccatgcc
ccgggagccttcgaccagctgctgtacgacgtgatgcaggaggcactccaggtccacttc
cagggactgcagtacagggagcgtaatgccggccgggaaattgatgagcacatggtggac
cagggattcaacaaccacatcggtgttcatccggaaactggcttcgtttacggcggcaac
aacttcaactgcggcacctggatggacaagatgggatcttcccagaaggcgggcaacaag
ggacgacccagtactccccgcgacggatccgccgtggagctgattggcctgcagtacgcc
tcattgcgtttcatgcagagtctggccgagaaggacataataccctactccggagtggaa
cgcaagggtccatctggggagaagaccaagtggacctacaaggagtgggcggaccgcatc
aaagacaacttcgataagttcttctttgtgtcggagtcggagaccggttccctggccaac
aagaagctcatctacaaggacagctacggcgccacccagagctggacggactaccagctg
cgctgcaacttccccatcaccttgaccgtggcccccgagctgtgtaatccccagaatgcg
tggcgagccctcgagcaggccagaaagtatatccagggacccctgggaatgaagacgctg
gatcccgaggactggaactacagggccaactacgacaattcgaacgattccaccgattgc
acggtggcccacggtgccaactaccaccagggaccggagtgggtgtggcccatcggattt
tacctgcgggcgcgtctgatcttcgccaagaagtgcggccacctggacgagactattgcc
gagacctggtccattctgcgcaaccacctgcgggagatgcagacgtcccactggcgggga
ttgccggagctgaccaatgacaacggtgcctactgcggagactcgtgccgcacgcaggcc
tggagcgtggcggccatcctggaggtgctctacgacctgcactccctgggggcggatgtg
gcataa

DBGET integrated database retrieval system