KEGG   Drosophila ananassae: Dana_GF13132Help
Entry
Dana_GF13132      CDS       T01059                                 

Definition
GF13132 gene product from transcript GF13132-RA
Orthology
K01371  
cathepsin K [EC:3.4.22.38]
Organism
dan  Drosophila ananassae
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF13132
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     Dana_GF13132
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C1: papain family
   Dana_GF13132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 392 aa AA seqDB search
MKLLLVLPFLVAAVSAQFGNGGRFGGGFGGGLGGGLGGGLGGGLGGGLGGLQNGLANAAG
AVQGAVGRIASVVPPVPLLNNVQSFGDFVAQTGKTYASAAEQQLRETAFSASKSLVDAGN
AAFASGASTFKLAVNAFSDLTHSEFLSQLTGRKRSSQGDAQAAASKQPPSVPAGAVPESF
DWRQHGAVTPVKNQGTCGSCWAFATTGTIEGHIARATGNLPVLSEQNLVDCGPQEFALVG
CDGGYQGYAMAFIHENQKGVSNSESYAYLDKQDTCKYNPSTSAAQIKGWAEIPVGDEELL
KKVVGTLGPVACSLYGTETLLNYDSGIYSDEQCNGEDPNHSVLVVGYGSENGQDYWIVKN
SWSAAWGEDGYFRLVRGKNFCNIAAECAYPVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccttttggttctcccattcctggtggctgccgtctcggcgcagttcggaaac
ggtggtagatttggcggtggatttggaggtggtcttggtggtggacttggaggtggtctc
ggtggtggtctcggtggtggtctcggaggcctccaaaatgggctcgccaatgcggcggga
gctgttcaaggagctgttggccgcattgccagtgttgttcctcctgttcccttgctgaac
aatgtccagagcttcggtgacttcgtggctcaaaccggcaagacctatgcttccgccgct
gagcaacagctgcgtgagactgccttcagtgccagtaagagcttggtggatgccggaaac
gcggccttcgcgtccggagcctcaacattcaagttggctgtgaatgccttctccgatctg
acccactctgaattcctgtcccagctgactggtcgcaagaggtcttcgcagggagatgcc
caagctgccgccagcaaacagcccccaagcgttcctgctggtgcagttcccgaatcgttc
gattggcgtcaacacggtgccgtcactcctgttaagaatcaaggaacctgcggatcctgc
tgggcttttgccaccaccggaactattgagggacacattgcccgtgccactggcaacctg
cctgttctgtccgaacaaaatctggtcgactgcggacctcaggagtttgctctggttggc
tgcgacggtggctaccagggatatgccatggctttcattcatgaaaaccagaagggtgtg
tcgaactctgaaagctatgcctatctcgataagcaggacacttgcaagtacaatcccagc
acttctgcagcccagatcaagggatgggctgaaattcctgttggagatgaggagcttctg
aagaaggtggtgggcactttgggcccagtagcttgctcgttgtacggaactgagactctg
ctgaattacgacagcggcatttactccgacgaacagtgtaatggcgaggatccaaaccat
tccgtcttagtcgtgggatacggatctgagaatggtcaggattactggatcgtcaagaac
tcgtggtcagctgcctggggagaggatggatacttccggcttgtccgtggcaagaacttc
tgcaacattgctgcagagtgtgcctacccagtggtttaa

DBGET integrated database retrieval system