KEGG   Drosophila ananassae: Dana_GF13485Help
Entry
Dana_GF13485      CDS       T01059                                 

Definition
GF13485 gene product from transcript GF13485-RA
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 981 aa AA seqDB search
MSLSPNPLQNSPHVEHNDKGHKMANGHTMSQEPSRRSSRCHDQLFSGSLNSLARKDDGSS
SGSDGCGDDTIGSGTGLVGLQNIANTCYMNSALQALSNLPPMTHFFINCSELVEYIADQS
ARRCKPAGLAKSYRRLMQDIWQDIEDRKDFIAPRGILYGIRSVHPMFRGYQQHDTQEFLR
CFMDQLHEELTEQVSLLPQPHSQAQKPNETDEDNEEEAAGASHTPASESEYDTCESSMSD
RSAEVLLKTEYFVTPCRTQSSSSALPDAHQVHLPQVQTQQQQQNTSASSDQKPVESARSI
ISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQTHSLSVQSLNAAET
SARSNEGWLAWMWNVLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKY
SRVLTLPEVLCIHLKRFRHDLSYSSKISSDVYFPLEGFDMRPYIHKDCKSQVPLYNLSSV
ICHHGTVGGGHYTCYARNVLNGRWYEFDDQFVTEVSPETVATCQAYVLFYQKHNPQMKIV
REQAMSLSTSHPLCESDIQFYVTREWLSRLATFAEPGPINNQDMLCPHGGILHSKAAMIS
QIAVPISQPLWDYLYRNFGGGPAVNIIFECEICKRAAETLARRQQYELNEFTKYNGLQNE
FDSTAIYAIAMPWLRSWQQFSRGKTHKEPGPITNEGIAAPSENSALNGNATVSCVRLGSD
YAQLNARLWRFLHSIYGGGPEIMLRQAISDDDDAEEIEIIDQDDECDDDEDDHEDEEENE
EEDISATAYQHNHSDTESNFGCRSTPSPSLSRSPSPTAKREPMEAESELRPVSPNSKRGR
SKMKVTALRLNMRKRGKRNRNAFKQHAEMFGAKGNYNANTNADMPATDHTDREKEKGKVR
ERTVAFQNDYSLPISISFQSDNFQVNGVHENKVRDKGKRRGNSSRSGSSSSNSNNNNKEN
VTLQKFVTLREANGPSDETDI
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgagtcccaacccactgcaaaatagtccccatgtagagcacaacgataaaggc
cacaagatggccaacggtcacacgatgtcgcaggagcccagtcgcaggagcagccgatgc
cacgatcaactctttagcggatcactcaactcgctggccagaaaggatgacggcagcagc
agtggcagcgatggatgtggagatgataccattggctctggcacaggacttgtcggtctg
cagaatattgccaatacttgttatatgaactcggcgctacaggctctgagcaatctgcct
cccatgacgcatttctttatcaactgcagtgagctggtggagtacatagcggaccagagc
gcccgacgctgtaagcccgccggactggccaagagctatcgccgcctaatgcaggacatc
tggcaggatatagaagatcgtaaagatttcattgctcctcgtggcattctgtacggcatc
aggtcagtccatccaatgtttaggggctatcagcaacacgatacgcaggaattcctgcgc
tgcttcatggaccaactacatgaggagcttaccgagcaggtctctctgttaccacagcct
catagccaggcacagaaaccaaatgaaacggatgaagataatgaggaggaggcggctggt
gcctcgcatactcctgcgtccgagagcgaatacgacacgtgcgagagcagcatgtcagac
cgatccgcagaggtgcttcttaagaccgagtactttgtgacaccctgtcgaacacaaagc
tccagtagcgccttgccagatgcgcaccaggtgcacctgccacaggtacaaacacagcag
cagcagcaaaacacatctgcgtcatcagaccagaagcctgtggaatctgctcgctctata
attagcgatgttttcgatggaaaacttctgtcctcggtacagtgcttgacctgcgatcgt
gtctcaacgcgggaggaaacattccaggatctgtccctacccattcccaaccgcgacttt
ctcaacgttttgcaccagacgcacagcctgagtgtccagagcctgaacgccgccgaaacg
tcagccagaagcaatgaggggtggctagcgtggatgtggaacgtactgcgttcctggatc
tatggaccttcggtaacgctttacgattgtatggccagcttctttagtgcggatgaattg
aagggcgataatatgtatagctgcgaacgttgcaacaagctgcgcaccggcatcaaatat
tcccgggttctcacattacccgaggttttgtgcatccaccttaaacgctttcgccacgac
ctctcctacagttccaagatttcgtccgatgtctactttccattggagggcttcgatatg
cgtccgtatatccacaaagattgcaaaagccaggtgcccctctacaacctatcctcggtg
atctgccaccatggcaccgtgggtggtggccattacacttgctatgctcgcaatgtgctg
aatggtcgatggtacgagttcgacgaccagtttgtgacggaagtatcccccgaaacggtt
gccacgtgccaggcatatgtacttttctaccagaagcacaatccccagatgaagatcgtg
cgagagcaggcaatgagcttgtccacttcgcatccgctctgcgagtcagacatccagttt
tatgttacgcgggagtggctttcccgacttgcgacattcgctgaaccgggtccgattaat
aaccaggacatgctctgtccacatggcggcattctgcattccaaggcggccatgattagc
caaattgcggtgccgatttcccaaccgctgtgggactacctgtaccgcaatttcggcggt
ggaccggcggtgaatatcattttcgagtgcgagatctgcaagcgagcggcggaaacgctt
gcccgacgccagcagtacgagctaaatgagttcaccaagtacaatggactccagaacgag
ttcgattcgacggccatttatgccattgcgatgccctggctgcgatcctggcagcagttt
tcgcgcggaaagacccacaaggagccgggaccgatcaccaacgagggcatagccgctcct
tctgagaatagtgccctgaacgggaacgccaccgttagttgtgtgcgtttagggtccgat
tacgcccaactcaatgccagactgtggcgattcctgcatagcatttacggcggtggcccg
gaaataatgttgcggcaagccatttcggacgacgacgatgccgaggagatcgagatcatt
gatcaggacgatgagtgcgatgacgatgaagacgatcacgaggatgaggaggagaacgag
gaagaggacatttctgccaccgcctatcagcacaatcattccgataccgagagcaatttc
ggttgccgctcaacaccaagtccaagtttgagtcgcagtcccagtccaacggccaagcgt
gagcccatggaggcggagtcggaactccggcccgtcagtcccaactctaagcgcggccgt
tccaagatgaaggtaaccgccctgcgcttgaatatgcgtaagcggggcaagcggaatcgc
aatgccttcaagcagcatgccgagatgttcggagccaaaggaaattacaacgccaacacc
aatgccgacatgccagcgacagatcatacggatagggagaaggagaagggcaaggtacgg
gagcgaactgttgcatttcagaacgattacagtctacccatttcaatatcattccaaagc
gacaatttccaggtgaacggtgtccacgaaaacaaggtgcgcgacaagggcaagcggcgt
ggcaacagttcccgtagtggcagtagcagtagcaacagcaataacaacaacaaagagaac
gtcacgctgcaaaagtttgtgaccctgcgagaggccaatgggccgagtgacgagactgat
atttga

DBGET integrated database retrieval system