KEGG   Drosophila ananassae: Dana_GF13485Help
Entry
Dana_GF13485      CDS       T01059                                 

Definition
GF13485 gene product from transcript GF13485-RA
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF13485
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF13485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 981 aa AA seqDB search
MSLSPNPLQNSPHVEHNDKGHKMANGHTMSQEPSRRSSRCHDQLFSGSLNSLARKDDGSS
SGSDGCGDDTIGSGTGLVGLQNIANTCYMNSALQALSNLPPMTHFFINCSELVEYIADQS
ARRCKPAGLAKSYRRLMQDIWQDIEDRKDFIAPRGILYGIRSVHPMFRGYQQHDTQEFLR
CFMDQLHEELTEQVSLLPQPHSQAQKPNETDEDNEEEAAGASHTPASESEYDTCESSMSD
RSAEVLLKTEYFVTPCRTQSSSSALPDAHQVHLPQVQTQQQQQNTSASSDQKPVESARSI
ISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQTHSLSVQSLNAAET
SARSNEGWLAWMWNVLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKY
SRVLTLPEVLCIHLKRFRHDLSYSSKISSDVYFPLEGFDMRPYIHKDCKSQVPLYNLSSV
ICHHGTVGGGHYTCYARNVLNGRWYEFDDQFVTEVSPETVATCQAYVLFYQKHNPQMKIV
REQAMSLSTSHPLCESDIQFYVTREWLSRLATFAEPGPINNQDMLCPHGGILHSKAAMIS
QIAVPISQPLWDYLYRNFGGGPAVNIIFECEICKRAAETLARRQQYELNEFTKYNGLQNE
FDSTAIYAIAMPWLRSWQQFSRGKTHKEPGPITNEGIAAPSENSALNGNATVSCVRLGSD
YAQLNARLWRFLHSIYGGGPEIMLRQAISDDDDAEEIEIIDQDDECDDDEDDHEDEEENE
EEDISATAYQHNHSDTESNFGCRSTPSPSLSRSPSPTAKREPMEAESELRPVSPNSKRGR
SKMKVTALRLNMRKRGKRNRNAFKQHAEMFGAKGNYNANTNADMPATDHTDREKEKGKVR
ERTVAFQNDYSLPISISFQSDNFQVNGVHENKVRDKGKRRGNSSRSGSSSSNSNNNNKEN
VTLQKFVTLREANGPSDETDI
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgagtcccaacccactgcaaaatagtccccatgtagagcacaacgataaaggc
cacaagatggccaacggtcacacgatgtcgcaggagcccagtcgcaggagcagccgatgc
cacgatcaactctttagcggatcactcaactcgctggccagaaaggatgacggcagcagc
agtggcagcgatggatgtggagatgataccattggctctggcacaggacttgtcggtctg
cagaatattgccaatacttgttatatgaactcggcgctacaggctctgagcaatctgcct
cccatgacgcatttctttatcaactgcagtgagctggtggagtacatagcggaccagagc
gcccgacgctgtaagcccgccggactggccaagagctatcgccgcctaatgcaggacatc
tggcaggatatagaagatcgtaaagatttcattgctcctcgtggcattctgtacggcatc
aggtcagtccatccaatgtttaggggctatcagcaacacgatacgcaggaattcctgcgc
tgcttcatggaccaactacatgaggagcttaccgagcaggtctctctgttaccacagcct
catagccaggcacagaaaccaaatgaaacggatgaagataatgaggaggaggcggctggt
gcctcgcatactcctgcgtccgagagcgaatacgacacgtgcgagagcagcatgtcagac
cgatccgcagaggtgcttcttaagaccgagtactttgtgacaccctgtcgaacacaaagc
tccagtagcgccttgccagatgcgcaccaggtgcacctgccacaggtacaaacacagcag
cagcagcaaaacacatctgcgtcatcagaccagaagcctgtggaatctgctcgctctata
attagcgatgttttcgatggaaaacttctgtcctcggtacagtgcttgacctgcgatcgt
gtctcaacgcgggaggaaacattccaggatctgtccctacccattcccaaccgcgacttt
ctcaacgttttgcaccagacgcacagcctgagtgtccagagcctgaacgccgccgaaacg
tcagccagaagcaatgaggggtggctagcgtggatgtggaacgtactgcgttcctggatc
tatggaccttcggtaacgctttacgattgtatggccagcttctttagtgcggatgaattg
aagggcgataatatgtatagctgcgaacgttgcaacaagctgcgcaccggcatcaaatat
tcccgggttctcacattacccgaggttttgtgcatccaccttaaacgctttcgccacgac
ctctcctacagttccaagatttcgtccgatgtctactttccattggagggcttcgatatg
cgtccgtatatccacaaagattgcaaaagccaggtgcccctctacaacctatcctcggtg
atctgccaccatggcaccgtgggtggtggccattacacttgctatgctcgcaatgtgctg
aatggtcgatggtacgagttcgacgaccagtttgtgacggaagtatcccccgaaacggtt
gccacgtgccaggcatatgtacttttctaccagaagcacaatccccagatgaagatcgtg
cgagagcaggcaatgagcttgtccacttcgcatccgctctgcgagtcagacatccagttt
tatgttacgcgggagtggctttcccgacttgcgacattcgctgaaccgggtccgattaat
aaccaggacatgctctgtccacatggcggcattctgcattccaaggcggccatgattagc
caaattgcggtgccgatttcccaaccgctgtgggactacctgtaccgcaatttcggcggt
ggaccggcggtgaatatcattttcgagtgcgagatctgcaagcgagcggcggaaacgctt
gcccgacgccagcagtacgagctaaatgagttcaccaagtacaatggactccagaacgag
ttcgattcgacggccatttatgccattgcgatgccctggctgcgatcctggcagcagttt
tcgcgcggaaagacccacaaggagccgggaccgatcaccaacgagggcatagccgctcct
tctgagaatagtgccctgaacgggaacgccaccgttagttgtgtgcgtttagggtccgat
tacgcccaactcaatgccagactgtggcgattcctgcatagcatttacggcggtggcccg
gaaataatgttgcggcaagccatttcggacgacgacgatgccgaggagatcgagatcatt
gatcaggacgatgagtgcgatgacgatgaagacgatcacgaggatgaggaggagaacgag
gaagaggacatttctgccaccgcctatcagcacaatcattccgataccgagagcaatttc
ggttgccgctcaacaccaagtccaagtttgagtcgcagtcccagtccaacggccaagcgt
gagcccatggaggcggagtcggaactccggcccgtcagtcccaactctaagcgcggccgt
tccaagatgaaggtaaccgccctgcgcttgaatatgcgtaagcggggcaagcggaatcgc
aatgccttcaagcagcatgccgagatgttcggagccaaaggaaattacaacgccaacacc
aatgccgacatgccagcgacagatcatacggatagggagaaggagaagggcaaggtacgg
gagcgaactgttgcatttcagaacgattacagtctacccatttcaatatcattccaaagc
gacaatttccaggtgaacggtgtccacgaaaacaaggtgcgcgacaagggcaagcggcgt
ggcaacagttcccgtagtggcagtagcagtagcaacagcaataacaacaacaaagagaac
gtcacgctgcaaaagtttgtgaccctgcgagaggccaatgggccgagtgacgagactgat
atttga

DBGET integrated database retrieval system