KEGG   Drosophila ananassae: Dana_GF13566Help
Entry
Dana_GF13566      CDS       T01059                                 

Definition
GF13566 gene product from transcript GF13566-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dan  Drosophila ananassae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF13566
Translation factors [BR:dan03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dana_GF13566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 237 aa AA seqDB search
MADDWESAADSEVVIRPNATNNINKWEGEDDDEDVKESWEDEEEKKDEEKPTKADVPVKT
KPNKALKAKLEEQARLEEEEEANRLANLTPEEKLAEKLRLQKIQEESDLKHALDAFGVTS
TGGGGLDAFNPESKEEFKEFGASLSWKIAQYKESPHFPQFVEDLVRGLCVNLSATDIKKV
KINVETLHSEKLKMEKANAKKPAGKGKGKATLRTENDDIDGYKKYGNDFTDDYDDFM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgattgggaatccgcagcggacagcgaagtagttataaggccgaatgccacc
aataacataaacaagtgggagggagaggacgatgacgaggacgtcaaggagagctgggag
gacgaagaggagaagaaggacgaggaaaagcccacaaaagcagatgtgccagtcaaaaca
aagccaaacaaggccctgaaagccaagttagaggaacaagcgagacttgaagaggaggaa
gaggcgaatcgattggccaacctcacgcccgaggagaagctggccgagaagctgcgcctc
cagaaaatacaggaggagtctgacctaaaacacgccctggacgcattcggcgtgacgagt
acaggaggtggcggcctcgatgccttcaacccggagagcaaagaggagttcaaggagttc
ggagcctccctcagttggaagatcgctcagtacaaagagtcgccacacttcccccagttt
gtcgaggatctggtgcgaggcctctgcgtgaatttgagtgctactgacatcaagaaggtc
aagattaacgtggagactcttcactctgaaaagctcaaaatggaaaaggcgaatgccaag
aagcccgctggcaagggcaagggcaaggcgacactgcgtacagaaaacgatgacattgat
ggttataaaaagtacggcaatgatttcaccgacgactacgacgactttatgtga

DBGET integrated database retrieval system