KEGG   Drosophila ananassae: Dana_GF13568Help
Entry
Dana_GF13568      CDS       T01059                                 

Definition
(RefSeq) GF13568 gene product from transcript GF13568-RB (EC:3.4.19.12)
  KO
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF13568
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF13568
Ubiquitin system [BR:dan04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dana_GF13568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1148 aa AA seqDB search
MPRNPFRWSRKFKTSSGAAASLSGSGSGHDNEERRGSHTAISSCRGGRGPPAQDSNNNKR
ARVLRRSSFRKFLNRITQHLTTSADNSYSDRIAFIEIVPFYTGCWRRKEANKPSSSNTGG
GGSLERVPPIGGYQWPADQTPGVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKVD
LKRRNKINSRKFGTKGELTEQLANVLKALWTCKNESDHSTSFKAVVDRYGTQFRSSTQHD
AQEFLFWLLDKVHEDLNTASKRRYKSLKNSYGRSDEVIAAETLANHIRCNNSFVQAVFQA
QFRSSLTCPRCDKQSNTFDPFHCISVQLPQLTQLTIFVTVVYIKKVPRQVKMGLRVPAGS
PIVALREQLQTDTGIEGSCMVLVDLNAEGFTRVFFDSQPVETVASNENIYCIEVPEATPV
PKAAGSGDSAAAAAPAPAPASVPAQADLLLLVANVYRAKDGKDVARFGAPFSMKAPRDCS
YQELQKRMLREMTLLLKPEVFSYATPPSEMFRIRLQDPSADPDTYLEQVEHPLLTEMIDL
ALSVLSAEAGPQHIKLLLEWSSPEEYFLASKEPDDVVEHESVARLSASKSGVTAALTLEQ
CLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQAAK
LTTMVKFPLTAFDMSPHLARGVHESASSSNGLGLSLGSANPWKRAKTGESRSSTLNSRSE
SKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDAIEEDIINNE
AYMLFYQRRSVDAGECSGSSSNSGDHWVSRLAPASSSSSASSTTGREKEAVKLEEASKVA
EKAVAQSKPVDIPNICNEKMEVTDAPEEVVTIEKSPPHELLGAEELAYADADVDGSGLSE
ESNGSLPVPASTTTADDEGLTLGEEATLIFAMDENCTELAEEEQEGKSPCPPQAEATDMT
VVPDEGMPAAETVKTNGHTTSSSSSLESSGSSRSSPRSLSTSVTAASTLHRKFNGHMTAT
ASLFNGTPPLSGSQISRHVQLHNHNWNGSRSSVSAEESATHQQQQHAAAAASLSLRHSFS
TSSNYTETLSSLLRNSANTCSKDTLLFIDQQNHHASDLMEDDDDSYMGRSLWISPLTPHK
LITVSPKN
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcaatcccttccgctggtcgcgcaagttcaagacctcgtccggggctgccgcc
tccctgtccggatccggatctggccatgataacgaggagcgacgtggcagccatacggcc
atttcgtcctgccgaggcggccgaggaccccccgcccaggacagcaacaacaacaagagg
gcacgagtcctgcggcgctcctcgtttaggaagtttctcaatcgaatcactcagcatctg
acaacgtcggcggataactcgtactcggatcgcatcgccttcatagaaatcgtgcctttc
tataccggatgctggcgcagaaaagaggccaacaagccctcatcctcaaacactggagga
ggcggcagcctggagcgcgtgcctcccatcggaggctaccaatggccggcggaccagacg
ccgggagtgatgggcctgaagaaccatggaaacacttgctttatgaacgcggtcctgcaa
tgcctcagccacacggacatccttgcagagtactttgtcctggaccaatacaaggtcgac
ctgaagcgacgaaacaaaatcaattcccgaaagtttggcaccaagggggaactcaccgaa
caactggccaatgtcctgaaggcactgtggacctgcaagaacgagagcgaccacagcacc
agcttcaaggccgtggtggacagatatggaacgcagttccgcagctccacgcagcacgac
gcccaggagtttctgttctggctgctggacaaggtgcatgaggacctgaacacggccagc
aagaggcgctacaagagcttgaagaattcctacggccgctccgacgaggtcatcgccgcg
gagaccctggccaaccacatacggtgcaacaacagcttcgtccaggccgtgttccaagcc
cagttccgctcctcgttgacctgcccgcgctgcgacaagcaatcgaacaccttcgacccc
tttcactgcatctccgtgcagctcccacagctcacccagctgaccatcttcgtcacggtc
gtctacataaagaaggtgccgcgccaggtgaagatgggcctgcgcgtcccggccggatca
cctatcgtggctctgcgagagcagctgcagacggacaccggcatcgaggggtcgtgcatg
gtgctggtcgacctgaacgccgagggattcacgcgcgtcttcttcgactcccagcccgtg
gagactgtcgccagcaacgagaacatctactgcatcgaagtccccgaggcgacccccgtg
ccaaaggcggctggaagcggcgatagtgcagcggcggctgcccctgccccagccccagct
tcagtcccagcgcaggcagacctgctcctcctagtggccaatgtgtacagagcgaaggac
ggcaaggacgtggctcgtttcggagcccccttcagtatgaaggcgccgcgcgactgctcc
taccaggagctgcagaaaagaatgctgcgcgaaatgacgctcctgttgaagccagaggtg
ttctcctacgccacgccgccgtccgagatgttccgcatccggctgcaggacccctccgcc
gacccggacacctacctggagcaggtggagcatccgctgctcacggagatgatcgacttg
gcgctgtccgtgctgtccgccgaggcggggccgcagcacatcaagcttcttctggagtgg
agctcgcctgaggagtacttcctcgccagcaaggagccggacgatgtggtggagcacgaa
agcgtggcgcggctgagtgccagcaagtcaggggttacggcagcgctgaccctggaacag
tgcctggagcactacaccaaggcggagaccctgagcgccgaggacgcctggcggtgcccc
cactgccagcagtacttgcccgtggtgaagacgctgggtctgtggtcgctgccggacatt
ctggtggtgcacttcaagcgcttccgtcagcaccagtcaaagggaccgcaggccgcgaag
ctgaccacgatggtcaagtttcctctcaccgccttcgacatgtcccctcacttggcgcgc
ggcgtgcacgaaagtgccagcagctccaatgggttgggactcagtctgggctcggccaat
ccgtggaagcgtgccaagaccggggaatcgcgctcctccaccctgaactctcgcagcgag
tcaaaggacacgcgctatgacttgtatgccgtgtgctaccaccagggggacactttggag
accggacactacacggccgcgtgcaagaacccctacgaccggcagtggtacaagtttgat
gaccagcgcgtcagcaaggtgccggaggacgccatcgaggaggacatcatcaacaacgag
gcgtacatgctcttctaccagcgacgcagcgtggacgccggcgagtgctccggctctagc
tccaactcgggagatcactgggtgtcccgcttagcacccgccagttcatcctcgtccgcg
tcctcgacgacgggacgggagaaggaggcggtcaagctggaggaagccagcaaggtggca
gagaaggcggtggcacagtccaaaccagtggacatacccaacatttgcaacgagaagatg
gaagttactgacgcaccagaagaggtggttacgatagagaagtcgccccctcacgagctg
cttggcgcggaggaactagcttatgccgacgccgatgtggatggcagtggtctcagtgag
gaaagcaatgggtctctgccggtaccagcctccactacaactgccgatgatgaaggcctg
acacttggcgaggaggcgactctcatttttgccatggacgagaactgcacggagctagcg
gaagaggaacaggagggcaagtctccttgccccccgcaggcagaagccacagacatgacc
gtagtcccagatgagggaatgcccgctgctgagacggttaaaaccaacgggcacaccacc
tcatcctcctcatcgttggagagctcaggttcttcgcgatcatcgccaagatcgctgagt
acgtcggtcactgcggcgtccacgctgcacaggaagttcaacggtcatatgaccgccacc
gcttcgctattcaacggaactcctccgctatcgggctcacagatttcgcggcatgttcag
ctgcacaaccacaactggaacgggtccaggagcagtgtgtcggccgaggagagtgccacc
caccaacagcagcagcatgcggcggcggctgcaagcttgagtctgcgccactccttctcc
acgagctcaaactacacggagacattgtcctccctgctccggaactcggccaacacttgc
agcaaggacactctgctgttcattgaccaacagaatcaccacgcgtcggacctaatggag
gacgacgatgactcgtacatgggcagatcgctctggatatcgcccttaacgccccacaaa
ctcatcaccgtttctccgaagaattaa

DBGET integrated database retrieval system