KEGG   Drosophila ananassae: Dana_GF13732Help
Entry
Dana_GF13732      CDS       T01059                                 

Definition
GF13732 gene product from transcript GF13732-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dan  Drosophila ananassae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dan00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dan00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 195 aa AA seqDB search
MANTETVFLALTAGMGILVTLVTHYRLYQDLETMRWRLKVLSLTVKDTFGQPISLNQFAG
QVLLVVNIASRCGLTSSQYAGLHELREKYEERGLSILNFPCNQFGAQMPESDGREILEHL
RQKKANIGHIFAKIKVNGRNADPLYKLLTRKAPRIEWNFVKFLIDRKGNIYGRYGAEKKP
AVLVNDIERLLLEAK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaacacagaaactgtatttctcgccctcacggccggaatgggaattctggtgact
ctcgtcacacattacaggctctatcaggacctggagactatgcgttggcgcttaaaggta
ttatccctgacggtgaaggacacttttggacagcccataagcttaaaccaattcgcgggc
caagtcctgctggtcgtgaatatagcttccagatgcggtctcacctcttcccaatatgct
ggcctacacgaactaagggaaaaatatgaggaacgtggcctgagcatcctgaactttcct
tgcaaccaattcggagcacagatgccagagtcggatggccgggaaatactggagcatctc
cgccaaaagaaggctaatataggccatatttttgcaaaaatcaaagtaaatggccgcaat
gcagatcccctgtacaagctactcacccgaaaagctccgcggatagagtggaattttgtc
aagtttctgatcgatcggaagggaaatatctatggccggtatggcgcagaaaagaagcca
gctgtcctggtaaatgacattgagaggttgctgctggaagccaaataa

DBGET integrated database retrieval system