KEGG   Drosophila ananassae: Dana_GF14113Help
Entry
Dana_GF14113      CDS       T01059                                 

Definition
GF14113 gene product from transcript GF14113-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 477 aa AA seqDB search
MPSFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVEPDRQKVMCKGGILKDDQWNL
QLKDGAVVLLLGSKESVPEVPATPVKFIEDMNEVEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALTGFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQDPSSTAVQKKQHSSFIDQWFGGTF
EVKMSSEEVPDEPSTVTTENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAQY
TRNYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMR
AKFKDLEDKKMEVDVVKPNEAKEEKKDIKYEQFWFDDDLGSNNSGYYSLQAVLTHKGRSS
SSGHYVAWVRSTGDVWFKFDDDDVSTVTSDEILRLSGGGDWHCAYVLLYAPRRLEKI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgtttaaagttaaggtaaagtggggccgggagctctacacagatattgttgta
aacaccgacgaggagcccatcttgtttaaagcccaattgtttgcgctcactggcgtcgag
ccggatcgtcagaaagtcatgtgtaagggaggcattcttaaggatgatcagtggaacttg
caactgaaagatggagctgttgttttgttgctgggcagcaaggaaagtgtaccagaagtg
cctgctacaccggtcaaattcatcgaagacatgaatgaagtggaagctgcaacagctatg
cgtctaccagccgggcttacaaaccttggtaatacatgctatatgaatgccaccgttcaa
tgtttgaacgcagtgcctgagcttcgtactgccttgactggcttcagcaacgacggaacc
gacacaatgtcaactgcattttcaatttcatctgccatgaaatccatatttgctcagatg
gagaagggcactaccgtgactccaattgtcctgctacaggctctgcaccgggcatctcca
caatttgcccagacgggtgaaaacggcacctaccggcaacaggacgccaacgagtgctgg
gcagaaattttgaagatgctccagcaaaagcttcgtcccacaaaccaagacccatcgagt
actgctgtccagaaaaagcaacacagttcgtttattgaccaatggtttggaggaactttt
gaagtaaagatgagttcggaggaagttcctgacgagccttccacagtgacaactgagaat
tttctgcagttgagttgctttatctcaatggatgtcaagtatatgcaaagtggtctaaaa
tcaaaaatgaaggagcaattggtgaagaaatcagagactttgggacgcgatgctcagtac
actagaaactacttggtgagccgactaccggcctatctgacggtccagtttgttcgcttc
caatacaaaggaaaagagggaattaatgcaaaggttttgaaggatattaagttcccgata
gactttgatgcctttgagttgtgcactcccgagttgcaaaacaagttgtgtcccatgcgc
gcaaaattcaaggatcttgaggacaagaaaatggaagtggacgttgtcaagccaaacgaa
gcgaaggaggagaaaaaggacatcaagtacgagcagttttggttcgatgacgacctggga
agcaacaattccggatactactccttgcaggctgtgttaacacataagggtagatcaagt
tcttcgggacattatgtggcatgggtgcgttctaccggcgacgtgtggttcaaattcgac
gacgatgatgtttcgacagtgacctccgatgagattttgcggctttcaggaggtggagac
tggcattgtgcatatgtccttctatatgcaccccgacgcttggaaaagatataa

DBGET integrated database retrieval system