KEGG   Drosophila ananassae: Dana_GF14119Help
Entry
Dana_GF14119      CDS       T01059                                 

Definition
GF14119 gene product from transcript GF14119-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF14119
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C67
   Dana_GF14119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 642 aa AA seqDB search
MNPKSDHETEKEKKLTITNTFGDSLENYDPDSDRGPHAYPKRNQNKKNGILKNTETHHSA
VDSSHQDLADILGQNWPKHAGPAAMILNKPRMAAESSISEDIKHYKDVVKPASPISIKIA
PEEPLQRFTVNDYQSLVEIPGTDLAIGSLVEVSNSVVCEDLYGVIRWIGFPPGASKSLLV
GIELEDESNLKSMITSDGRHNGVRLFTCQDGRAVFVPANKCTADRRFADVDTSNTVNKVS
NNQAKKFGVADCPAVYGSVPPLEIHNSEELSSICGKFKGIQGHHNSCYLDATLFSMFTFT
SVFDSILYRQPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSG
LTCEEKDPEEFLNSLLSQIMKVEPFLKLSSGQDSYFYQLFVEKDEKLTFPSVQQLFEQSF
HSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLEVTDIIENSPRQCFICGKLAEYE
CRDCFGNLQSGYGLESTSFCPQCLKLNHSHAKRNNHVSKKISVPKDYRKRADHMDAPRVY
MELFAVVCIETSHYVAFVKAGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLS
EEGARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaaatccgatcatgaaacagaaaaagaaaaaaagttgaccattaccaatacg
tttggagactcactggagaactatgatcccgatagtgaccgtgggccccatgcttaccca
aaaaggaatcaaaataaaaaaaatggaatactaaaaaataccgagacacatcacagtgct
gtggacagttctcatcaggatctagcagatattcttgggcagaattggcctaagcacgca
ggtcctgcagctatgatcctcaacaagccaagaatggctgccgaatcaagtataagcgaa
gatattaaacattataaagatgttgttaaaccggcgtccccaatttccataaaaattgca
ccagaagagccactccaacgttttactgttaatgattaccagtcccttgttgaaattcct
ggcaccgatctggcaataggatcccttgtagaagtgtccaattccgtagtatgtgaagat
ctgtatggcgtcataagatggatcggtttcccacctggcgcatctaaaagtttactggtt
ggaattgagcttgaggacgaatcaaacttaaagagtatgataacttcagatggaagacac
aatggggttcgcctatttacgtgccaagatggtcgggctgtttttgtgccagcaaataag
tgcacagccgaccgccgatttgctgatgtggataccagtaacacggtgaacaaagtttct
aataaccaagcaaagaagtttggcgtcgcggactgcccggctgtttatggatcagtccca
cctttggagatacataactctgaggagctgtcgagtatttgtggaaaattcaaaggaatc
caaggacatcataattcgtgctatcttgatgcaaccttgttttcaatgtttactttcaca
agtgttttcgattcaatattgtatagacaaccgggaccacaagacattcgaaattatagt
gaggtccaaaaagtgctgcgcgacgaaatcgtcaatccgctgcgaaaaaatgtttttgtg
cgatcagatcgcgttatgaaactgcgtgagcttctagatcagcttagctccgtcagcggc
cttacctgcgaagaaaaagatcccgaggagttccttaacagtttactgtcacaaataatg
aaagtcgaaccctttctaaagctaagttcaggacaagattcatatttctatcagctcttt
gtggaaaaggatgaaaagttaacgtttccgagcgttcagcaactatttgagcaaagtttt
cactcatcggacattaaactcaaggaggttccctcttgttttattatccagatgcctcgt
ttcgggaaaaattacaaaatgtatcccagaattttgccatcgcaagtgctggaagtgaca
gatataattgaaaactcacctcggcaatgctttatttgtggtaaactggctgagtacgaa
tgtcgtgattgctttggaaatttacaatctggctatggactggaaagtacctccttttgt
ccccaatgccttaaattaaatcactcccacgctaaaagaaataaccacgtttcgaaaaag
atttcggtgccgaaggattacagaaaaagggctgaccatatggatgctccaagagtttac
atggaattgttcgccgttgtttgcattgagacatcccactatgtggcgtttgtaaaggcc
ggttcaggacctgatgcaccttggtgcttttttgattctatggccgatagaaaaggtgaa
cagaatggatacaatatacctgaaataacttgcgttcccgaattaacacaatggctctcg
gaggaaggcgcgcgatctattaatgaaacttcaacgaacgacaaagtattacctgaacac
gctaagcgtattttttgcgatgcctatatgtgtctgtaccaaagcacagatataatgatg
taccattag

DBGET integrated database retrieval system