KEGG   Drosophila ananassae: Dana_GF14127Help
Entry
Dana_GF14127      CDS       T01059                                 

Definition
GF14127 gene product from transcript GF14127-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dan04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dan04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 940 aa AA seqDB search
MASISDDGMVLSGYHKKLKTMKKKFFVLYEETSINQARLEYYDTEKKFLQRAEPKRVIYL
KDCFNINRRLDTKHRFVIVLSSREGGFGIVLESENDLRKWLDKLLLLQRNIANVNGQVYS
AYEHVWQVIIQKKGMSEKVGITGTYHCCLSAKSLTFVCIGPEKTANGDDRISSIEILLTT
IRRCGHASPQCIFYMELGRQSVLGSGELWMETDNAAIATNMHNTILSAMSAKTDSNTNLI
NVYQARPDISHEPMRKRSSSANEASKPINVIQNRQNSLELRNCSSPHNYGFPRERCDSLP
TRNGTLSESSNQSYFGSNLGLRSNTISGIRPHSTSKHSNSPTFNMPLRCSESEDSSISID
ESDDNASFGHYRLNTRSSKGAIPEENLDDFASAEYCKGSGPSGDDNYIPMTPIKPASFCE
PDKVELPKPDDPNLHINFPEHTSEKLENDFDLDSDNQCGRPIRAYSIGNKVEHLKLNRRL
GYLNDTGQNSNRVRAYSVGSKSKIPRCDLQRVVLVEDNRFDTNRSQNNISKEGPISGTST
NREKKSTSAPLLSLKNQINQDRMSDLMEIDFSQSSKIEPWTPAQFKRNVMDVVPKNIESV
FPKSYRNDSSNLTLHATSQKDIFNGGKLNTTESSSEGGYLEMKPVGNAFSSSPVTLPSKI
EKLKLKDNTELPVHELHKVSSYNIPPEKRKEQTPTQTRIEEKTLNSQLNEKLINTESANV
VANITPNVPELKSDKKNNVESLIIENNNWDLGTTDEKKLVHSISSEDYTQIKDKLNDLTK
NNEVGYKILQIKSDSSLISSKITLKNRLRDNLERQQRLTESVNTIPDKSPSATTKGTFYS
LGNNFQTPPNNVVNNTLDNILQTKDLNFPSRPSSQASQPELHYAKLDLPNCSDQNPAKYL
KRGSRESPPVATCAEDGNTYARIDFDQSDSSSSSSKIFNM
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatctgatgacggaatggtccttagtggctatcacaaaaaattaaagact
atgaaaaagaagttcttcgtcctctacgaagaaactagtatcaaccaagcacgtctggag
tactacgacactgaaaagaaattcctgcaaagagcggaaccaaaaagagtcatctacttg
aaggactgcttcaatataaaccgacgtctagacaccaagcacagatttgtcatcgtgcta
tcttcgagggaaggcggatttggaattgttctcgagagcgagaatgatttacggaagtgg
ttggataaactactactcctacagcggaatatagccaatgtaaatggacaagtgtattca
gcatatgagcatgtttggcaagttatcattcagaaaaaaggaatgtcggaaaaagtcgga
attactggaacctatcattgttgcctttctgccaaatcgctgacatttgtatgcattggc
ccggagaagaccgctaatggagatgatcgaatatccagcatagagattctcctaactacc
attaggcgatgcggacatgcttctccgcaatgtattttctacatggaactcggccgccag
agtgtactgggttctggggaattgtggatggaaacggataatgcagctatcgctacaaat
atgcacaatacgatattaagcgccatgtcagctaaaacagattccaacacgaatttaata
aatgtttaccaagctcgaccagatatcagccatgaaccgatgagaaaacgttcatcatct
gcaaacgaagcttcaaagccaattaacgtaatacaaaatcgccaaaactctctcgaattg
cgaaattgtagctcgccacacaactatggttttccgagggagagatgcgatagtttacca
accagaaatggaactctgagcgagagctccaaccaatcatactttggatcaaatctggga
ctaagatccaacaccatttccggtatccgtccacattcaactagcaagcacagcaacagt
ccaacgttcaacatgccattgagatgctccgaatctgaagattcgtcaattagtatcgat
gaatccgatgataatgcaagttttgggcattatcgtttaaatactaggtcatcaaagggg
gctattccagaggagaaccttgacgactttgctagtgcagaatattgcaaaggctcagga
ccaagtggtgacgataactatataccgatgacacctattaaacctgcatcattctgtgaa
ccagataaggtggagttgccaaaacccgatgatcctaatttgcatattaactttccggag
cacacatccgagaagctggaaaatgactttgacttggattccgataatcaatgtggacgg
cctattcgtgcatattcgataggaaataaagttgagcatttaaagcttaatagacgactt
ggatatttaaatgataccggacagaattcgaatcgtgtacgtgcctactcagtcggttct
aagtcaaaaatcccccgatgtgatttgcagcgagtggttcttgtggaggacaataggttc
gacacgaacagaagccaaaacaacatttcaaaggagggccccatcagcggtacaagtaca
aacagggaaaagaaatcaacaagtgcgccgctcttgagtttgaaaaaccaaataaatcag
gatcgtatgagcgacttaatggaaatcgacttttctcagtcgtctaaaatagaaccttgg
acgcccgcacaattcaaaaggaatgtgatggatgtggtgcccaagaatatcgaaagtgtg
ttcccgaaaagctatagaaacgatagctccaacttgacattgcacgccaccagtcaaaaa
gacattttcaatggaggtaaactgaatactaccgagagcagttcagagggtggttacctt
gaaatgaaaccggttgggaacgccttcagttccagtccagttacccttcctagcaaaata
gaaaagctcaagctaaaagacaacaccgaattgccggttcatgaactgcacaaagttagc
tcgtataatattccgccagaaaagcgaaaggagcaaacgccaacgcaaacgcgaatcgaa
gagaagacccttaactcccaactgaatgagaaactaattaacacagaatctgcaaacgtt
gttgccaatattacccccaatgtccctgagcttaaaagcgataagaaaaataatgttgaa
agtttaattattgagaataacaactgggatctgggtaccacggacgaaaagaagctggtt
cattcaataagtagtgaggattacacccaaattaaagataaattgaacgatttgacgaaa
aataacgaagtaggctacaagattcttcaaataaaaagcgatagttcccttatctcatcg
aagataaccctgaagaacaggctccgggataatttagaacggcaacagagattaaccgaa
agtgttaatacgattcccgacaaatcacccagcgccaccaccaaaggcactttctattca
ttaggaaacaattttcaaacaccaccaaacaacgtagtcaacaatactttagacaacata
ctgcagacaaaagatttaaattttccatcacggccatcttcacaagcatcccaaccggag
ctccactatgcaaaactcgatcttccaaattgcagcgatcagaacccagcgaaatatttg
aaaagaggttcacgcgaatctccgccagttgccacctgcgctgaagatggaaatacgtat
gcgagaattgattttgatcaatcagactcatcttcttcctcatcgaaaatatttaatatg
taa

DBGET integrated database retrieval system