KEGG   Drosophila ananassae: Dana_GF14193Help
Entry
Dana_GF14193      CDS       T01059                                 

Definition
GF14193 gene product from transcript GF14193-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dan  Drosophila ananassae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dana_GF14193
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dana_GF14193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 519 aa AA seqDB search
MGKSVDVVVMGSAAIEYITHVAELPKPGEMVPGIHMETAFGGKGANQSIAAARLGAVTTF
LGKMGADESGEQYKSYLTDQNIDTKQVELVKNTATGMTEVALTEEGEFYRINVAGANKSM
TSKDISRHKKIMNKSRVLLCQLELDMNTTACALRQFKGGVSILHLSPMRSDIPNELITLP
TILVMNQDAAATLANMDEVRTLLQARKACEALVDGGANSVIILMEDNSAVHMSKNNKEMC
THIPAGDVRYVADSSGSDDAFMGGLAYHIARFPKLPREHHISAANACAAYSMGIRGTQPS
FPGPYLAQDNLCYITPTFTVIDENSEEAPEEQRKETIQAPAPEPTPEPAAEPSPPPEEPA
PPPPAEDPAPEEAPKAKTKEEERNTVAEANKAYISIKTELELVGSSSPESIKDQPDADNI
KMFVGQIPKTWDETRLRHMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDA
LHNIKTLDGMHHPIQMKPADSENRNAISYKHWLLNNNAK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatcggtggatgtggtggtcatggggtcggcggccatcgagtacataacccat
gtagccgaactccccaagcccggagagatggtccctggaatccacatggagactgctttt
ggcgggaagggcgccaatcagagcatagcagcggccaggttgggagccgtcaccacattc
ctgggcaagatgggggcggatgagtccggcgagcagtacaagagctacctgaccgatcag
aatatcgacactaagcaagtggaactggtgaagaacacggccactggcatgaccgaggtg
gccctgaccgaggagggcgagttctacaggatcaacgtggcgggggccaacaaatccatg
accagcaaggacatttctcggcacaagaaaataatgaacaagtctcgcgttctgctctgc
cagctggaattggacatgaataccaccgcctgtgccctgcgccagttcaaaggtggtgtt
tccattctccacctctctcccatgcggagcgacatacccaacgagctgatcaccttgccc
accattttggtaatgaaccaggacgcggccgctactctggccaacatggacgaggttcgg
actctgctccaggccaggaaagcttgcgaagccctggttgatggcggggcaaatagtgtg
atcatcctaatggaggacaatagtgccgttcacatgtccaaaaacaacaaggagatgtgc
acccatattcccgccggcgatgtacgatacgtggccgactcctccgggtcggacgatgcc
ttcatgggaggcctggcgtaccacattgccaggttcccgaagctgccccgcgagcaccac
atcagtgccgccaacgcctgcgccgcctactccatgggcatccggggtacccagcccagt
tttccgggcccatacctggcgcaggacaacctgtgctacatcacgcccaccttcactgta
atcgacgaaaattccgaggaggcgccggaggagcagagaaaggaaacaattcaagcacca
gcgccagaaccgactccggagccagcggcagaaccctcacctcccccagaggagccagca
cccccaccaccagcagaggacccagccccagaagaagctccaaaagccaagacgaaggag
gaggaacgcaacacagtcgctgaggccaataaagcttacatctccatcaaaaccgaactg
gaactggttggctcaagcagtccggaatctatcaaggaccagccggatgcggacaatata
aagatgttcgtcggccagatacccaagacctgggatgagacgcgactccggcacatgttc
gagcagttcgggcccgtgcacaccctgaacgtccttcgcgacaaggtcacatcaattagc
cgcgggtgctgttttgtcacctactatacacgaaaggctgccctgcgcgcccaggatgcg
ttgcacaacatcaagaccttggacgggatgcaccaccccatccagatgaagccggcggac
agtgagaaccgaaacgctatctcttacaagcactggctgctcaacaataacgccaaataa

DBGET integrated database retrieval system