KEGG   Drosophila ananassae: Dana_GF14193Help
Entry
Dana_GF14193      CDS       T01059                                 

Definition
(RefSeq) GF14193 gene product from transcript GF14193-RI (EC:2.7.1.15)
  KO
K13207  
CUG-BP- and ETR3-like factor
Organism
dan  Drosophila ananassae
Brite
Spliceosome [BR:dan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dana_GF14193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 332 aa AA seqDB search
MMLQSLNLQADKLSGISSATATATETEAATVAATTSATSEQARDPTVEVTTTMLTTAPVA
HVANGSNSNTSESNNNSLYSSSNLNSSNNSQQQQQIQSVKYLENLTSSGASSGAIAAPTT
FTGAAKSFHPYLRPTGTTSSTISSISNSNNSAAALSTTTATSGAKMSSTLFETLLHNQIN
SSPTAPTVPPLPAATLAIATPPTPSTAATATAATAAAAAVAAASAVMPLNSSINSRTSLG
EQGGIVAVPSNRISIKTELELVGSSSPESIKDQPDADNIKMFVGQIPKTWDETRLRHMFE
QFGPVHTLNVLRDKVTSISRDAPPHPDEAGGQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgcaatccttgaatttgcaggcggataaactgagcggcatctcatctgcaaca
gcaacagcaacagaaacagaagcagcaacagtagcagcaacaacatcagcaacatcagag
caagcacgcgacccaacagtagaagtaacaacaacaatgcttacaacagcacctgttgcc
catgttgctaatggcagcaacagcaatacgagcgaaagtaacaacaatagcctctacagt
agcagcaatttaaatagcagcaacaatagccaacaacagcaacagatacagtcggtcaag
tatttagagaatctaacgagctcgggagcaagttcaggtgccatagcagcgccaacaact
ttcacaggtgctgcgaaaagtttccatccctatttgcggcccactggcaccaccagcagc
accatcagcagcatcagtaatagcaacaacagtgcggcagcattatctacaacaacggca
acatcgggggcaaaaatgtcctcgacattgtttgaaacacttttgcacaaccaaataaat
tccagcccgacggcaccgaccgtgcccccactgccagcagcaacactagcaattgcaaca
ccaccaacacccagcaccgcagcaaccgcaacagcagcaactgcagcagcagcagcagta
gcagcagcatcagcggtaatgccgctgaattccagcattaattccagaacttcattaggc
gagcagggtggcattgttgccgttccctcaaatcgcatctccatcaaaaccgaactggaa
ctggttggctcaagcagtccggaatctatcaaggaccagccggatgcggacaatataaag
atgttcgtcggccagatacccaagacctgggatgagacgcgactccggcacatgttcgag
cagttcgggcccgtgcacaccctgaacgtccttcgcgacaaggtcacatcaattagccgc
gatgcaccaccccatccagatgaagccggcggacagtga

DBGET integrated database retrieval system