KEGG   Drosophila ananassae: Dana_GF14216Help
Entry
Dana_GF14216      CDS       T01059                                 

Definition
GF14216 gene product from transcript GF14216-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dan  Drosophila ananassae
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dan04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2470 aa AA seqDB search
MSTSSVVQQFVNGLKSRNRNVQNKAHQDLMFYVKTELREMSQEELTQFFDEFDHHIFNMV
NATDINEKKGGALAMKCLINCEGSLTARKGIAPYLNRLRDLLLINDVSVMEIAARSMVKL
ANMPTSKGAVSFDFDIKKAFEVLGSERQEYRRHAAVFILREVAIALPTYFYQHIITFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRECTKQSSEPQWYRICYDKANGSFGADLAAG
KDQKGVTRDDRIHGGLIVVNELFRCANATWERRYTSLKTLFPRSSHKSLEAGISSGVGSQ
FNTLVPRLKVPFIDRLGGTQSSLGDTSDQHNGAAKFTGHNVLESAYAHEILHEHYTTICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRDVFVEKYLKSCVSHLMQILRGKEKDRTVAFI
TIGYMAVAVESAIEKHLSGIMSSVKLSLPAKDLASKRKVPVDPAIFACITLLAHAVKSEI
ADDVRDILEQMFYTGLSPSLTVCLRELSENVPQLKSPITDGLIGVLSQVLMNKPAAIPYA
AIPPIAIDPSLMQNVDTATKVLALKTLGTFNFEEQNMLDFVQRCADYFIIHEQQEIRLEA
VQTCTRLLKLAVQSSENMDNSKTLSDTVSHVIERLLMVAITDLDCNVRIQILRSLDETFD
AKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDLKYS
GMNRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA
EVNGGSNEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE
NQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTTVVQAVTYIFQSLGIKC
VPYLAQVLPNLLDNVRTADNNLRDFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTLNT
ALPMQNTLINLIEQIAVALGCDFRDYLAELIPQILRFLQHDNSKDRMVTRRLLQALQKFG
STLGYYLPLIVPPIVKLFDSPYVPQQVSLVALETINNLACQLDFTDFSSRIIHPLVRVLE
AEPELRDQAMITLRSLVKQLGKKYLVFVPMVQRTLVKHRIVDPEYEKLLSRIQSNSTLAD
ASGAGEFGLRPAKIKNNEPFVNDSNSNNKITQATTYELRTVWQVTRRVSKDDWVEWLKRL
SIGLLKDSPSHALRACLMLAQEYETLLRDLFNAAFISCWTELPPDLKTELTQSLIQALQV
TDMPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDPQ
VFESLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYERNLHTDS
SDVEARLGHMRCLEALGDWSELSSVTKHEWENFNTEAKARASPLAAVAAWGLQDWEAMRE
YVRCIPEDTQDGSFYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMV
CVQMLAELEEVIQYKLIPERREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDDIH
TWLKYASLCRKSGSLHLSHKTLVMLLGCDPKLNPQQPLPCNQPQVTYAYTKYMAENNQLQ
EAYDQLRHFVNTYSQELSCLPPEALKQQDQRLMARCYLRLATWQNKLQDSIGPDAIPGAL
ECFEKATSYDPNWYKAWHLWAYMNFKVVQAQKTALDKQQQQQGLGMGMSLDNDRLDNDLL
IIQQYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTW
LQVIPQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKIL
DSMRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLH
AMLGRGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQL
PQLTSLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISHIKTNLQVITSKQRPRKLCIS
GSNGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLTIQRYAVIPLSTNSG
LIGWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEYALGQTQ
GDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILH
IDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLM
AVLEAFVYDPLLNWRLLDVDKKGNDAPAGNGGAGGGRGGSGIQDSLSDSMEESLPMAKSK
PYEAHLHLQQADETNSKASQVIKRVKCKLTGTDFQTQKSVNEQQQVELLIQQATNNENLC
QCYIGWCPFW
NT seq 7413 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgtcgtcggtggtgcagcagttcgtgaacgggctaaagtcccgcaacagaaat
gtgcagaacaaggcccaccaggacctgatgttctatgtgaagacggagctgcgggagatg
tcccaggaggagctgacgcagttcttcgacgagttcgatcaccacatcttcaacatggtg
aatgcgacggacattaatgagaaaaagggaggagcccttgctatgaagtgcctcatcaac
tgtgagggcagtcttactgctcggaaaggtattgcgccttacctcaaccgtcttagggat
ctgctcctgataaacgacgtgtccgtcatggagatagcggctcgttccatggtcaaactg
gcgaacatgcccacttccaagggtgcggtgtcgtttgatttcgacatcaagaaggccttc
gaggtgctcggcagcgaacgacaagagtatcgccggcatgccgccgtcttcatcctccgc
gaggtggccatcgccctgcccacctacttctaccagcacatcatcacattcttcgaggtg
atcttcaatgcgatcttcgatcccaagccagccattcgagagtccgccggagaggccctg
cgagctgccctgatcgtcaccgcccagcgggagtgcaccaagcagtcgagtgagccgcaa
tggtaccggatttgctacgacaaggccaatggaagctttggcgcggatctggcggctgga
aaggatcaaaagggtgtgacgcgggatgatcgcattcacggaggccttatcgttgtcaac
gagctgttccgctgcgcaaatgccacctgggaacggcgctacacgtcgctgaaaaccctc
ttcccgaggtcttcgcataagagcctcgaagcaggcatctcctcgggagtgggctcgcaa
ttcaacactctggtcccgcgactaaaggtgccattcatcgataggcttggcgggacacaa
tcgagcctgggcgataccagcgaccaacacaacggggcggcgaaattcactggccacaat
gtcttggaatcggcatacgcccacgagatcctacacgagcactacaccaccatttgcgac
aatgtcctggagcagcgaacttcgaagtcaccgtatgtgcagcaggccctcctacagata
ctgccacggctagccgcctttaatcgcgacgtctttgttgagaagtatctgaagtcgtgc
gtgtcccacctgatgcagattctgcgcggaaaagaaaaggatcggactgtggcgtttatc
acgatcggctacatggcagtggctgtggaaagtgcaattgagaaacacctctcggggatc
atgagcagtgttaagctctccctcccggccaaggacttggctagcaagagaaaggtgcct
gttgatcctgcaatctttgcgtgcataacgttgctagctcacgccgtcaagtcggagatt
gcagacgatgtgcgcgacatcctggagcagatgttctacaccggcttgtcgccatcgtta
actgtttgcctgcgggagctgtccgagaatgtgccgcagctaaaatcgcccatcacagac
ggactcatcggagtgctgtcccaggtgctgatgaataaaccggccgctattccatacgct
gccatcccgccgatcgccattgatccctcgttgatgcaaaatgtggacactgccaccaag
gtgctggccctcaagacgctgggaacattcaactttgaagaacaaaacatgttggacttt
gtacagaggtgcgccgactactttatcatccacgaacagcaggagattcgccttgaagcc
gttcagacttgcacacgacttctcaagctggcagttcaatcatcggagaacatggacaac
tccaaaaccctcagcgacactgtctcccacgtcattgaacgcctgcttatggtggccatc
acggatttggactgcaacgtgagaatccagatcctgcgctccctcgatgagactttcgac
gcgaaactagcccagccagagtcgcttaactcactattcatcactctgcacgacgagatc
ttcgagattcgggaactggcaatggtgaccattggaaggctctcctccatgaacccagcg
tatgtcatgcccaagttaaggaccaccatgatcgagctgctgactgatttgaagtactcg
ggaatgaacagaaacaaggaacagagtgccaggatgttggatcacttggtcatcagtacg
cctcggctcatttcctcgtacatgaatccaatcctcaaggcgctggtgccgaaactacat
gagccggagtcgaatcctggggttatcctgaacgtactccgcaccattggcgacctggcc
gaggtgaatggcggctccaatgagatggagctgtgggccgatgacttgctctccattcta
ctggagatgctgggggatgcaggcagtccggacaaacgaggagtggccctgtggacgttg
ggacaactgattagtgccaccggaagagtcgtgactccatatcacaagtaccctgtgctc
atcgacattctgatcaacttcctgaaaacggagcagcgcagatccatccggagggaaacc
atccgagtgctgggcctactgggcgcgatggatccctacaagcataaaatgaataaggga
ctgattgacagccagaaggacaacgttctgattgcctactccgatggaaaggtggatgaa
aaccaggacatctccaccgcggagctgttggtcaacatgggcaacgccctggacgagtat
tatccggcggtggccatagctgctctgatgcgaattctgcgcgatcccacgctgagcacc
cggcacacgactgtcgtccaggcagtgacctacatcttccagagtcttggaataaagtgc
gtgccctacttggcccaagttctgcccaatctgctggacaatgtgcgcaccgctgacaac
aaccttcgcgatttcctgttccagcagctggccattctagtggcctttgtgaagctccac
atcatcagctacatgggcgacatcttcaagctgataaaagagttctggaccctcaacacg
gcactgccgatgcagaacacgttgatcaatctgatagagcagattgctgtggccttgggg
tgcgatttccgagactacttggcggagctgataccacaaatcctgcgctttctgcaacac
gacaactccaaggacagaatggtcactcgaagactactccaggctctccagaagtttggc
agcaccttggggtactacttgcctctgattgtgccgccgatcgttaagctgttcgattcg
ccctatgtgccccagcaggtctccctggtggccttggaaacaatcaacaacctggcctgc
cagctggacttcaccgacttctcctcccgcatcatccatccgttggtgcgtgtgttggag
gcagagcccgagttgcgagaccaggcgatgatcacactccgctcgctggtcaagcagctg
ggcaagaagtacctggtgtttgtgcccatggtgcagcgaaccctggtcaagcaccgcatc
gttgatcccgagtatgagaaacttctaagcaggatccagtcgaacagcacgctggcagat
gcaagtggggcaggagagtttggtcttcgaccggccaagatcaaaaataacgaaccgttt
gttaacgacagtaacagtaacaacaagatcacacaggccaccacctacgagcttcgaacg
gtatggcaggttactcgacgggtgtccaaagacgactgggtggaatggttgaagagactg
tctatcggcctgctgaaggactccccatcacacgccctgcgagcctgtctcatgttggcc
caggagtacgaaaccctgctgcgagacctatttaacgcggccttcatttcctgctggacg
gagctgccgccggatctgaagactgagctgacgcagtcgctgatccaggctctgcaagtg
actgatatgccggagatcacccaaaccatcctcaacctggccgagttcatggagcactgc
gatcgggatcccatacccattgaaaccaagctactgggtactcgagcaatggcttgcaga
gcttatgcgaaggctctacgctacaaggaagaagagttcctgctgagagaggatccacag
gtgttcgagtcgctgatcctcatcaacaacaagctgcagcaacgggaggcagcggagggt
cttctgaccacctaccgaaatgcggccaacgagctgaacgtgcagggaaggtggtacgag
aagctccataactgggaccaggcattggagcactacgaacgaaaccttcacacggactcc
tcggacgtggaggcgcgtctgggccacatgcgctgcttggaggcactcggcgactggtca
gagctgagcagtgtcaccaagcacgagtgggagaacttcaatacggaagccaaggcacga
gccagtcccctggctgctgtggcggcatggggtctccaggactgggaggccatgcgagag
tatgttaggtgcatacccgaggacacccaggatggcagcttctaccgggccgtgttggcc
gtccaccacgatgactttgagacagcccagcggttaattgacgagacacgggatctcctg
gacaccgagctcacctcgatggcgggcgaatcgtacgaacgagcctacggcgccatggtc
tgtgttcagatgctggccgagctggaggaagtgatccagtacaagctaattcccgaaaga
agagaaccattgaaggcaatgtggtggaagaggctccagggcggacagcgtttggtggag
gactggcgccgcatcatccaagtccactcgctggtggtgaagccacacgacgacattcac
acctggctgaagtacgcgagtctgtgtcggaagagcggctcgctgcacctgtcgcacaag
acgctagtgatgctgctgggctgtgatccgaagctgaatccccagcagccgctcccgtgc
aatcaaccccaggtcacctacgcctacaccaagtacatggcggagaacaaccagttgcag
gaggcctacgaccagctgaggcacttcgtcaacacctacagccaggagctgagctgcctg
ccgccggaggccctcaagcagcaggaccaacgcctgatggcgcgctgctaccttcggcta
gccacctggcagaataagctgcaggacagcatcggcccagacgcgataccgggtgccttg
gaatgcttcgagaaggccaccagctacgatcccaactggtacaaggcctggcacctgtgg
gcctacatgaacttcaaggtggtccaggcccagaagaccgccctggacaagcagcaacaa
cagcagggactgggcatgggaatgagtctcgacaacgatcggttggacaacgatctgctg
atcatccagcagtatgcagtgccagccgtgcagggcttcttccgctccatcagcctgatc
aagggcaactccctgcaggacacgttgcgactgctgaccctctggttcgactacggcaac
catgccgaggtctacgaggctttgctctccggcatgaagctgatcgagatcaacacttgg
ttgcaggtgatcccccagctgattgcacgcatcgacacccatcgccagctggtgggccaa
ctgatccaccagctgctcatggacattggaaagaatcacccgcaagctctggtctatccc
ctgacagtggcctctaagtctgcctcgctggctcgccgaaatgctgccttcaagattctg
gactccatgcggaagcactcgccgactttggtggaacaggccgtgatgtgcagtgaggaa
ctcatccgggtggccatcctctggcacgagcagtggcacgaaggcttggaggaggcctcg
cgactgtacttcggggatcgcaatgtcaagggcatgttcgaaatcctggagccactgcac
gccatgctgggccgaggtccacagactctgaaagagacgtccttctcgcaggcctacggc
cgggagctaacggaggcgtacgaatggtcgcaacgctacaagacctccgccgtggtgatg
gacctcgaccgtgcctgggatatatactaccatgtcttccaaaagatctcgcgccaactg
ccgcagctgacctcgttggagctgccttatgtgtcgcccaagctgatgacctgcaaggac
ctcgaactggcagtgcccggctcgtacaatcccggccaggagctgatacggattagtcac
ataaagacgaacctacaggttatcacctcgaaacagcgaccacggaagttgtgcatctcc
ggatcgaatggtaaggactatatgtatctgctgaaaggacacgaggatctgcggcaggac
gagcgcgtgatgcagctgttttctctggtgaacactcttctgcttgacgatccggacacg
ttccggcgaaacctgaccatccagcggtatgccgtcatcccgctgagcaccaactccggc
ctgatcggctgggtgccccactgcgacaccctgcacaccctgatccgggactatcgggac
aaaaagaaggtgcccctgaaccaggagcaccgcaccatgcttaactttgcgcccgactac
gaccatctgacgctgatgcagaaggtggaggtgtttgagtacgcccttggccaaacccag
ggcgacgacctggccaagctgctctggctaaagtcaccatcttcggagctgtggttcgag
cgccgaaacaactacacccgctcactggccgtcatgtccatggttggctatattctgggc
ctgggcgaccggcatccctcgaatcttatgctggaccggatgagcggcaagatattgcac
attgacttcggcgactgctttgaggtggccatgacacgggagaagttccccgagaagatc
cccttccggctgaccaggatgctgatcaaggcgatggaggtcaccggcatcgaaggcact
taccgccgcacctgcgaaagcgtgatgctggtgctgcgccgcaacaaggactccctaatg
gccgtactggaggcctttgtgtatgatcctttgctgaattggcgtctcctggatgtggac
aagaaaggcaacgatgcgccggccggaaacggcggagctggtggtggaagagggggctcc
ggaatccaggattcccttagcgactcgatggaggagtcgctgccgatggccaagtcgaag
ccgtacgaggcacacctgcacctgcagcaggcggacgagacgaacagcaaggccagccag
gtgatcaagcgggtcaagtgcaagctaaccggcaccgacttccaaacgcagaagagcgtc
aacgagcagcagcaggtggagctgctcatccagcaggcgaccaacaacgagaacctctgc
cagtgctacatcggctggtgtcccttctggtga

DBGET integrated database retrieval system