KEGG   Drosophila ananassae: Dana_GF14223Help
Entry
Dana_GF14223      CDS       T01059                                 

Definition
GF14223 gene product from transcript GF14223-RA
Orthology
K01001  
UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
dan  Drosophila ananassae
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dana_GF14223
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     Dana_GF14223
Glycosyltransferases [BR:dan01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Dana_GF14223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 409 aa AA seqDB search
MSGAAIAINSAISGAAYYMAIRMIPRFRDMFIKANLFGNDLCKKDKPQVPESFGVLIGCV
YLVSLFLFIPIPFAFDEAAATDAVTGGKPDTFPHDKFVELIAALLSICCMIFLGFADDVL
DLRWRHKLLLPTIATLPLLMVYYVNYNSTTIIMPNFARDLIGTSLNIGVLYYIFMGMLAV
FCTNAINILAGINGLEVGQSVIIAGSILIFNCIELYLGHQVESHIFSIYLMLPFAATTLA
LWKFNKYPSQVFVGDTYCYFAGMTFAVVGILGHFSKTLLLFFLPQVLNFLYSTPQLFHFV
PCPRHRLPKYDSKTDLLHISTTEFRMEELNPVGRLMVKTLQKLRLISWQARPDGLIRTNN
FTLINFVLVIFGPVHERVVTQMLMAFQAVCTLIALTIRYPLANYFYAKT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagcagccattgcaatcaattctgcaatttcgggagccgcctactacatggcg
attaggatgatacctcgcttccgggacatgttcatcaaagcgaacctcttcggcaacgat
ctctgcaaaaaggacaagccccaggttccggagtcctttggcgtgcttattggatgcgtg
tatctcgtctccctgtttcttttcatccccatcccttttgccttcgatgaagcggctgcc
acggatgcagttacgggcgggaagccggacacttttccccacgacaagtttgtagaattg
attgccgccttgctatccatttgctgtatgatcttcctaggcttcgccgacgacgtcttg
gatttgcggtggcgccacaagttgttgctacccacgattgcaacgctgcccctgctcatg
gtctactatgttaactataactccaccaccattattatgccgaactttgcaagggacctg
attggaacctcattgaacataggcgttctatactacatctttatgggcatgctggctgtt
ttctgcacaaatgccatcaacatcctggcgggcatcaatggcctggaagtcggccagtct
gtcataatcgctggttccattctgatcttcaactgcatcgaactatacctgggtcatcag
gtagagtcgcacatattctccatctacctaatgctaccgttcgcggcgaccaccctggcg
ctctggaagttcaacaagtatccctcgcaggtgtttgtcggcgacacatattgctacttt
gctggcatgaccttcgccgttgtgggcatcctgggccacttcagcaagactctattgttg
ttcttcctgccacaggtcttaaacttcctgtattccacgccgcaattgtttcattttgtg
ccttgccctcggcatcggctgcccaaatacgacagcaagacggatctgctgcacatcagc
accacggagttccgtatggaggagctgaaccccgtgggacggttgatggtcaagactctc
caaaagctgcgactaatcagctggcaggccagaccagacggcttgataaggaccaacaac
ttcaccctcatcaacttcgtgttggtcatattcggtccagtccacgagcgagtggtcacc
cagatgctaatggccttccaggcagtctgtacactgatagctctgaccattcgctacccg
ctggccaactacttttacgcgaaaacgtaa

DBGET integrated database retrieval system