KEGG   Drosophila ananassae: Dana_GF14259Help
Entry
Dana_GF14259      CDS       T01059                                 

Definition
GF14259 gene product from transcript GF14259-RA
Orthology
K03099  
son of sevenless
Organism
dan  Drosophila ananassae
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dana_GF14259
   04630 Jak-STAT signaling pathway
    Dana_GF14259
   04068 FoxO signaling pathway
    Dana_GF14259
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dana_GF14259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1587 aa AA seqDB search
MFSGPSGHAHHHHHTISYGGGIGIGAGGGSGGVGGGGVGGSALQECDGYDFTKGENAARW
RGLFAPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEKVNKSF
PAPIDQWALNEAKEVINSKKRKSVLPTERVHSLLQKDVLQYKIDSSVSAFLVAVLEYISA
DILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQRASATY
EETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELDPIFSNIMDIYEVTVTLLGSL
EDVIEMSQEQNAPCVGSCFEELAEAEEFDVYKKYAHDVTSQASRDALSNLLSKPGASSLI
SAGHGFRDAVKYYLPKLLLVPVCHAFVYFDYIKHLKDLSSSQDDIESFEQVQGLLHPLHC
DLEKVMAGLSKERMVPVSGRVRRQLAIERTRELQLKVEHWDDKDVGQNCNEFIREDSLSK
LGSGKRIWSERKAFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKFFMRRVEIIDRADS
DDLKNSFELVTRMQPALVLTAKNAQHKHDWMADLLMVNTKSMLDRILDSILQDIERKHPL
RMPSPEIYKFAVPDSGDNIVLEDRESAGVPMIKGATLCKLIERLTYHIYADPTFVRTFLT
TYRYFCSPQQLLQLLVERFNIPDPSLVYQDAGITGTGGIGGGGGDKEHKNSQREDWKRYR
KEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKWVDSVLKIVQ
RKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFEMYKNVK
PSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMM
VMLELNNFNGILSIVAAMGTASVYRLKWTFQGLPERYRKFLDECRELSDDHLKKYQERLR
SINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLN
EESTIRQFFEQLDPFNGLSDKQMSDYLYNESMRIEPRGCKTVPKFPRKWPHIPLKSPGIK
PRRQNQTSSSNKVNSTSSAAALASTTATTIATAAAPSAQASSTVDPSATTTNAATGTLAG
EQSPQHNPNAFSVFAPVIIPDRSTLSSWSGTPLHTRVAPVDNNNGEVAVPAPHLPRKPAA
HVWSNNPSLANASNMDAFSPSLPEHLQLQSLPDSNTFADSDAPPSPLPKLVVSPRHETGN
RSPFHGRMQYSPTHSIASTVTLMGMAGGNLAAEEVSPQTGGFYYNSANQGHTGAVPISPH
VNVPAASNLEYRAVPPPLPPRRKERTDSCADMAQKRQAPDAPTLPPRDGELSPPPIPPRL
NHSMGISYLRHSHGQGKEFVGKSSLLLPNTSSIMIRRNSAIEKRAAAAGQPTEPAAMGIP
NTTLVTVSQSTALDEQPPQSISPALSSSTTTSPHTSTPATPMSPNIPSHPVESTSSSYAH
QLRMRQQQTHSAIYSHHHHAQHLPHHHPQHQHSNQQSQPRSSPKEFFPITSSLEGTPKLP
PKPSLSANFYNNPDKGTMFLYPSTNQE
NT seq 4764 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggacccagcggccatgcacaccaccatcaccataccatcagctacggtggc
ggaatcggaattggcgctggtggtggtagtggtggcgttggtggtgggggcgttggaggg
tctgctttgcaagaatgcgatggctacgactttaccaagggcgagaacgcggcccgctgg
cgtggcctttttgcgccctctttgaagaaggttttggagcaggttcatccgcgcgtcacc
gccaaggaagatgcacttctctatgtggagaaactttgcctccgtcttctggcaatgtta
tgcgccaagccactgccccactccgttcaggatgtggaggaaaaggtcaacaaatcgttt
ccagccccaatagatcaatgggccctcaacgaggcaaaggaggttatcaattccaagaag
cgaaaatccgtcctgcccacagagcgggttcactcgcttctccagaaggacgtgttgcag
tataagatcgacagctcggtttcagctttccttgtggccgttctcgaatacatttccgcc
gacattctcaaaatggctggcgactatgtcattaaaatcgctcattgcgaaattaccaag
gaggacatcgaggtggtaatgaacgccgatcgcgtcctcatggacatgttaaaccagagc
gaggcacacattctacccagcccgctgtcgctgccggcacaacgagccagtgccacctac
gaagagacggtcaaggaactgattcacgatgagaagcagtatcagcgagatttgcacatg
atcatccgagtcttccgcgaggaactggttaagatcgtctcggatcctcgagagctggat
ccgatattctcgaacatcatggacatctacgaagtgacggtaacactgcttggctccctt
gaagacgtcatcgagatgtcgcaggaacagaacgcgccttgcgttggcagctgttttgag
gagctggcagaggctgaggagtttgatgtgtacaagaagtatgcgcatgacgttacatct
caagcgtcgcgagatgcactcagtaatctattatccaaaccaggagcatcatctcttatc
tccgctggacacggctttcgggatgccgtcaagtactatctgccgaagctgctattggtt
cctgtctgccatgcctttgtttacttcgactacataaagcatctcaaagatctcagctcg
tcgcaagacgacatcgagagcttcgagcaggtccaaggcctgctgcatccgctccactgc
gatctcgaaaaggtaatggccggcctctccaaggagcgcatggtcccagtcagtggacgt
gtgcgtcgacagctagctatcgagcgaaccagagagctccagcttaaggtggagcactgg
gacgataaagacgtgggccagaattgcaatgaatttattcgggaggactcactgagtaag
ctgggatctggcaagagaatatggagcgagcgcaaggctttcctcttcgatggtttaatg
gtgttgtgcaaggcaaacacgaagaaacaaacaccatcagcgggagctaccgcctacgat
taccggttgaaggagaaattcttcatgaggcgtgtggaaattattgaccgggcggacagc
gatgaccttaagaacagtttcgaactggttactcgaatgcaaccggccctagtactgacg
gcaaagaacgcacaacacaagcatgattggatggcggacctgttgatggtgaacacgaag
tcaatgttggatcgaatattggatagcatactgcaggacattgaaagaaagcatccactg
cgaatgcctagtccggaaatatacaaattcgcagtgccggatagcggcgataacattgta
cttgaggatcgggagagtgctggggttccgatgatcaaaggagcgactctgtgtaaatta
attgagcgactcacctatcacatctacgcggatcctacctttgtgcgcaccttcctcacc
acatatcgatacttctgctcgccccaacaacttttgcagctgttggtggaacgttttaac
atccccgatcccagtctagtgtaccaggatgctgggatcacgggaactggtggcatcggc
ggcggtggcggcgataaggagcacaagaattcgcagcgcgaggactggaagcgctaccgc
aaggaatacgtccagccagtgcagttcagggtactgaatgtacttcgccactgggtggat
catcacttctacgactttgagaaggatccaatgctgctagagaaactcctcaactttctg
gagcatgtgaacggcaagtccatgcgcaaatgggtagactctgtactcaagattgttcaa
cgaaagaacgaacaggaaaaaagcaataaaaagattgtctacgcctacgggcacgatcca
ccacccattgagcatcatctcagcgtcccaaatgatgagatcacccttctaactctgcat
cccctcgaactagctcgacagcttacattgctagagttcgagatgtacaagaatgtaaag
ccctccgaactagtgggctcaccgtggactaaaaaggacaaggaggttaaaagccctaat
ttactaaaaatcatgaaacacacaaccaacgtgacccgctggatagagaagtccattacg
gaggcggaaaattatgaggagcggttggccatcatgcagcgggctatcgaagtgatgatg
gtgatgctggaactaaataactttaatggaatcctctccattgtcgccgccatgggcaca
gcatcggtttatagacttaaatggacattccagggattgccggagcgatacagaaagttt
ttggatgagtgtcgggagctgagtgatgatcatctgaagaagtatcaagaacgcttgcgg
tctattaatcccccttgtgtgccattcttcggtcgctacctgaccaacatactccactta
gaggagggcaatcccgatctactggccaataccgagctaattaacttctcgaagagacgg
aaagtggccgagataattggggaaatccaacagtaccaaaatcaaccatactgtctcaac
gaggagtccactatccgacaattcttcgagcaactagatccgtttaatggtctgtccgac
aaacagatgtccgactatctctacaacgagagcatgcgcattgagccaaggggctgcaaa
acggtgccgaagtttcctcgtaaatggccgcacattccgcttaaatcgccgggcatcaag
cctcgtcgacagaatcaaaccagcagcagcaacaaggtgaacagcacttcgtctgcggcc
gccttagcatcgacaacggccaccacaatagccacagctgctgcgccatcagcccaggcg
tcgagtacggtagatccaagcgcaacaacgaccaatgctgcaactggaactctcgccggt
gagcagagcccacagcacaatcctaatgcgttctcagttttcgcgccggttataataccg
gatcgaagtactttaagtagctggagcggcacacctctacatactagggtggcaccggtg
gacaacaataatggggaggttgcagtgccggcaccgcatctcccccgcaaaccagcggca
cacgtatggtcgaacaatcctagtctggccaatgcgtcgaacatggatgcgtttagtccg
tcgctgcctgaacacttgcaactgcaatcgctgccggacagcaatacgtttgctgattcg
gatgccccgccctctcctctgccaaagctggtggtcagcccgcgtcatgagactggaaac
cgctcgccattccacggacgaatgcaatacagcccaacgcacagtatcgctagtactgtg
acactaatgggaatggctggaggtaatctggctgcagaggaagttagcccccagacgggt
ggattttattacaatagcgccaatcagggacacaccggagcagtgcccatctcaccccac
gtcaatgtccctgcggcttcaaatctagaatatcgagcggttccgccaccattaccgccc
cgccgcaaagagcgaacggatagttgcgcggatatggcccagaagcgacaggcgccagac
gcaccaacattacccccgcgtgatggcgaactgagtcccccgccaataccaccccggctc
aaccattccatgggcattagctacttgcgtcatagccatggtcagggaaaggaatttgtg
ggaaagagtagtttgcttttgcccaacaccagcagtattatgattcggcggaactctgcg
attgagaaacgggctgcagccgctggccaaccaacagagccggcggcgatgggtatacct
aacactaccttggtgacggtgtcgcaaagtacggcgttggacgagcaaccgccacagtca
atctcgcctgccctgagctcatcgaccaccacatcgccacacacatcaactcccgccact
cccatgtcgcccaacattcccagccatccggtcgagagcacgtcgagcagctatgcgcat
cagttgcgaatgcgacaacagcagactcattcggcgatctactctcatcaccatcatgcg
cagcatcttcctcaccatcacccccagcaccagcattcgaatcagcaatcgcaaccgcgt
tcgtcccccaaagagttctttccgataaccagcagcttagagggcacccccaaacttcca
ccaaaacctagtctgagcgctaacttctataacaatccagataaaggtacgatgtttctt
tacccaagtacaaaccaagaataa

DBGET integrated database retrieval system