KEGG   Drosophila ananassae: Dana_GF14288Help
Entry
Dana_GF14288      CDS       T01059                                 

Definition
GF14288 gene product from transcript GF14288-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dan  Drosophila ananassae
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dana_GF14288
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dana_GF14288
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dana_GF14288
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dana_GF14288
   00511 Other glycan degradation
    Dana_GF14288
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF14288
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dana_GF14288
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF14288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 661 aa AA seqDB search
MAVSACVIIAVMALTVGLCVGLGSSDEVREDQPRFTIDHEANSFMLDGEPFRYVSGSFHY
FRAVPEAWRSRLRTMRASGLNALDTYVEWSLHNPHEDEYNWEGIADVVKFLEIAQEEDFY
IILRPGPYICAERDNGGLPHWLFKKYPSIKMRTNDPDYIAEVGKWYAQLMPRLQHLLVGN
GGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIDNVFA
TTDFGIDRINEIDEIWKMLRVQQPTGPLVNSEFYPGWLTHWQEQNQRRDGQVVADALKTI
LSYNASVNLYMFFGGTNFGFTAGANYDLDGGIGYAADITSYDYDAVMDEAGGVTSKYDKV
KAVIGEFLELPEITLNPAKRIAYGKVEVTPALALLSAEGRAALSKGDPVESVKPKTFEEL
DQYSGLVLYETELPTMDLDPALLKVDQIHDRAHVFVDQELVGTLSREARIYSLPLSKGWG
NTLQLLVENQGRINFYISNDTKGIFGDVSLQLHNGGYLPLENWRSTAFPLDQASVELWRR
ERSVQKDLDSFLARQRILRNGPLVYTGTFTVGEVGDTYLNMAGWGKGVAYVNGFNLGRYW
PVAGPQVTLYVPNELLKVGENSVVILEYQRANKTTNGADLPAVQFDAVAQLDGQCGDVTL
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgagtgcttgtgtgatcatcgccgtgatggccctcaccgtcggcctatgtgtg
ggcctgggcagtagcgacgaagtacgcgaggaccagcccaggttcaccatcgaccatgag
gccaacagcttcatgctggacggagagccttttcgctatgtctctggatcattccactat
ttccgggcggtgccagaggcctggcgaagtcgattgcgaaccatgcgagcatccggtctc
aatgcacttgatacctatgtggaatggtctcttcacaatccccacgaggacgagtacaac
tgggagggtattgctgatgtggtgaagtttctggagattgcccaggaggaagacttctac
attatcctacgcccaggaccatatatatgtgccgaaagagataacggaggccttccccac
tggctctttaagaagtacccctctattaaaatgcgaaccaacgatcccgactatatagcc
gaggtgggtaagtggtatgcccaactaatgccacggctccagcacttgttggtcggcaac
ggaggcaaaataatcatggtccaagtggagaacgagtacggagactatgcctgtgaccac
gactacttgaactggctgcgtgacgagactgagaagtacgtgtctggcaaagccctactg
ttcacggtggacatccccaacgagaaaatgagctgtggaaaaatagataacgtgttcgcc
accacggactttggtatcgatcgcattaatgaaattgacgaaatatggaaaatgctgcga
gtccaacaacccactggcccgttggttaactctgagttctaccctggttggcttacccat
tggcaggagcagaaccaaaggcgagatggccaggtggtagctgatgcattgaaaaccatt
ctcagctataatgcgagcgtaaacttatacatgttcttcggtggaaccaactttggattc
actgccggagccaactacgacttggacggagggattggttatgcagcggatatcaccagc
tatgactacgatgcagtgatggatgaagccggtggggttacctccaaatacgacaaagtc
aaggctgtgattggtgagttcctggagttgcccgagatcacgttgaatcctgccaagcgt
atagcgtacgggaaagtggaagtaacacccgcactggccctgctctctgcagaaggaaga
gctgccctctcaaagggcgatcctgtggagtcggtcaagcccaaaacattcgaggaattg
gaccaatactcgggactggtgctgtacgaaacagagcttcctaccatggacctggacccg
gccctcctcaaggtggatcagatccatgaccgcgcacacgtcttcgtcgaccaggaactg
gtgggcaccctatcccgcgaggcccggatctactcgctgccacttagtaaaggctggggc
aacactctgcagctgctagtggaaaaccagggtcggattaatttctacatttccaatgac
acaaagggtattttcggcgacgtgagcctgcagctacacaatggtggctacctaccgctg
gagaactggagaagtactgcctttccgctggaccaagcctctgtcgaactctggcgacga
gagcgtagtgtccaaaaagacctggactcgttcctggccagacaacgcatcctgcgcaat
ggacccctcgtgtatacaggcaccttcacggtgggggaagtgggcgacacctacctgaac
atggccggatggggcaagggagtggcctatgtaaacggcttcaatctggggcgctactgg
cctgtagccggtccccaggttaccttgtatgtgccgaacgaactcctcaaggtgggagag
aactctgttgttatcctggagtaccagcgcgccaataagacgacaaacggcgccgatctg
cccgccgtgcagttcgatgcagtggctcaactggatggacagtgcggcgacgtcactctc
aaataa

DBGET integrated database retrieval system