KEGG   Drosophila ananassae: Dana_GF14290Help
Entry
Dana_GF14290      CDS       T01059                                 

Definition
GF14290 gene product from transcript GF14290-RA
Orthology
K05759  
profilin
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 153 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQHPERESSL
LLFLVTKEELAKLISGFDQQDLLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTT
QAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagactacgtcgacaaccaactccttgcctcgcaatgcgtgaccaaagct
tgcattgccggacacgatggcaacatctgggcgcagtccaatggctttgaggtgacaaag
gaggagctggccaaactgatcagcggtttcgaccagcatccagagcgagagtcgagctta
ctcctgtttttggtgacaaaggaggagctggccaaactgatcagcggtttcgaccagcag
gacctgctcaccagcaacggcgtaacacttgccggccagcggtacatctacctttccggc
acagaccgcgtggtgcgtgccaagctcggcaggagcggagtgcactgcatgaagacaaca
caagccgtgatcgtttccatctatgaggatcccgttcagccccagcaggccgcatctgtc
gtggagaaacttggagattatctaattacttgcgggtactag

DBGET integrated database retrieval system