KEGG   Drosophila ananassae: Dana_GF14290Help
Entry
Dana_GF14290      CDS       T01059                                 

Definition
(RefSeq) GF14290 gene product from transcript GF14290-RC
  KO
K05759  
profilin
Organism
dan  Drosophila ananassae
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dana_GF14290
Membrane trafficking [BR:dan04131]
 Others
  Actin-binding proteins
   Others
    Dana_GF14290
Cytoskeleton proteins [BR:dan04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dana_GF14290
Exosome [BR:dan04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dana_GF14290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQQDLLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagactacgtcgacaaccaactccttgcctcgcaatgcgtgaccaaagct
tgcattgccggacacgatggcaacatctgggcgcagtccaatggctttgaggtgacaaag
gaggagctggccaaactgatcagcggtttcgaccagcaggacctgctcaccagcaacggc
gtaacacttgccggccagcggtacatctacctttccggcacagaccgcgtggtgcgtgcc
aagctcggcaggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tatgaggatcccgttcagccccagcaggccgcatctgtcgtggagaaacttggagattat
ctaattacttgcgggtactag

DBGET integrated database retrieval system