KEGG   Drosophila ananassae: Dana_GF14331Help
Entry
Dana_GF14331      CDS       T01059                                 

Definition
GF14331 gene product from transcript GF14331-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dan  Drosophila ananassae
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dana_GF14331
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dana_GF14331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MAQKLRIAIIGQSNFAADVLELLLERSNIEIVGVFTIPDKGSREDILATTATAHKIPVFK
FASWRRKGVTVPEVLEQYKTVGATLNVLPYCSQFIPMEVIDGAPLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDTIYKRFLYPEGVKA
MGVAVDMVANGSAPKITQTEVGATYDPAMFKAENQVLNLQQSAERIWNFVRGLDSVPGAI
VTVIQPDGTEEEIRLFGAHLYSAGPVSGGQALRLKGLNKPAWIHSAGLLIEGTDGAFVNV
RRVKRGSKVINASQWFQQGQQQPITDFSEDELAKKAQLTGIWQAIIKQQIEPSTDFFAAG
AGSMDVVRLVEEVKDAFDVPLENEQVFMAPVFEEFFDLLVRTLRQGSGGGDGQQLAYEGF
TLKANKREIRVPTQLFINGEFVDAEKRATLDIVNPTDEEVLCQVACASANDVDKAVQAAH
SAFYGSWKQISPRQRGQLMLNLADLMEKHKEELATIESVDSGAVYTLALKTHIGMSIDAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLVTPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSEAGQAVADHQLVRKLGFTG
STPVGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDLDKAVKHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFVRRVVKDLRSMTIGDPLNRSTAHGPQNHKAHFDKLLEFSQRGVAEGA
TLVYGGGRVPNLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDVDSVMQRANR
TEYGLASGVFTQDINKALSFADRIEAGTVFINVYNKTDVAAPFGGFKQSGYGKDLGQEAL
NDYLKTKCVTIEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaactgcgtattgccattattggccaaagcaattttgcggcagacgtcttg
gagctgctcctggagcgctccaatattgagattgttggggtcttcacaattccggacaaa
ggaagtcgagaggacattctggccaccacagccaccgctcacaagattcctgttttcaag
ttcgccagttggcgtcgcaaaggagttaccgtgccagaggtattggagcagtacaaaaca
gtgggagctactctgaatgtgctgccctactgctcccagtttattcccatggaggttatc
gatggagcgcccctaggaagcatctgttatcatccgtccattttgccgcgtcatcgagga
gccagcgccatttcctggacactgatcgagggcgacgaggtggccggcttcagcattttc
tgggccgacgacggcctggacacgggaccgcttcttctcacccgtcagaccaacctggag
cccacggataccctggacaccatctacaaacgtttcctttaccccgagggcgtcaaagct
atgggagttgccgtcgatatggtagccaatggatctgcccccaaaataacacagacagag
gtgggtgctacctacgatccggccatgttcaaagcggagaaccaggtgctcaatcttcaa
caatctgccgagcgtatatggaactttgtgcgaggactggactcggttcccggagccata
gtcacagtgattcagccggacggcaccgaagaagagattcgactctttggagctcacctg
tactccgccggcccagtttccggcggccaggccctgcgcctcaagggcctcaacaagccg
gcatggatccacagtgccggtctcctcatcgagggtacggacggtgccttcgtcaacgtc
cgccgtgtaaagcgcggctccaaagtcatcaatgccagccagtggttccaacaaggccaa
cagcaacccattaccgacttcagtgaggacgagttggccaagaaggcgcaactgaccgga
atctggcaggccataatcaagcaacagatcgagccatcgacggatttctttgcagccggc
gcaggatctatggatgtggtacgtttggtggaggaggtgaaggatgcctttgacgtgccc
ctggagaacgagcaggtgtttatggcccccgtgtttgaagagttcttcgacctgctggtt
aggactctacgccagggaagtggcggtggagatggtcagcaattggcctacgaaggcttc
actctgaaagccaacaagcgcgagatccgagttccaacccagctcttcatcaacggtgag
ttcgtggacgctgagaaacgtgccaccctggacattgtgaaccccaccgatgaggaagta
ctctgccaggtggcttgtgcatcggccaacgatgtcgacaaggcagtgcaggctgctcac
agtgccttctatggatcgtggaagcaaatctcgcccagacagcgaggccagctaatgctc
aacctggccgatttaatggagaagcacaaggaggaactggccactattgaatcggtcgac
tcgggagcagtgtatactctggccctcaagacccacatcggcatgtccatagatgcctgg
cggtactttgccggctggtgcgacaagatccagggaaacacgatccccgtcaacccggcc
agacccaacaacgtcctgaccttcactcgcaaagaacccatcggcgtctgcggtctggtg
acaccatggaactatcctttaatgatgctttcctggaaaatggctgcctgcattgcggcc
ggaaacacatgtctcattaagcccgcccagacttgccccctgactgctctcaaatttgcc
gaattgacagtccgagcaggattccctccaggtgtaataaacgtcctgcctggcaaggga
tccgaagctggtcaggcagtggccgatcatcaacttgtacggaaactgggcttcaccgga
tccacgcccgtcggcaagcacattatgaagtcctgcgcggattcaaacctcaagaagtgc
tcgctggagctgggcggcaagagtccgctgataatcttcgccgactgtgatctggacaag
gccgtcaagcacggcatgtcttcggtgttcttcaacaagggagagaactgcatcgctgcc
ggacgtcttttcgttgaagatcgtattcacgatgagtttgtacgacgtgtcgtcaaggac
ttgcgttcgatgaccattggggatccacttaaccggtccactgcccacggaccccagaac
cacaaggcccacttcgacaagctcctggagttctctcaaaggggcgtggccgagggtgcc
acgctggtctacggcggtggccgtgttccgaatctcaagggatacttctttacgcccacg
gtgtttacaaacgtgacggacgacatgttcattgcccaggaggaatcctttggcccaatc
atgataatctcaaagttcaacggcagcgatgtggattctgtgatgcagcgcgccaatcgc
actgagtacggcctggccagcggagtcttcacccaggacattaacaaagccctcagcttt
gccgatcgcatcgaagccggaactgtgttcatcaatgtttacaacaagaccgacgtggct
gctcccttcggaggcttcaagcagagcggatatggcaaggacttgggtcaggaggccctt
aatgattatctgaagacgaagtgtgttaccatagaatactaa

DBGET integrated database retrieval system