KEGG   Drosophila ananassae: Dana_GF14425Help
Entry
Dana_GF14425      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dan  Drosophila ananassae
Pathway
dan00564  Glycerophospholipid metabolism
dan01100  Metabolic pathways
Module
dan_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF14425
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dana_GF14425
    2.7.1.82  ethanolamine kinase
     Dana_GF14425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 6497250
NCBI-ProteinID: XP_001962477
FlyBase: FBgn0091452
UniProt: B3ML80
Position
Unknown
AA seq 548 aa AA seqDB search
MCICLLCQSNKEPKRKTMSNNLQKATLEEIRYAAARICRDHLNGRWKTVAPEDLIVKRVS
GGLSNFLYYVSLPAFIEYEEEEVEQLLLQKQQQIEGSVNGKDVISTSESGNSPVYARDDD
EVETKSVGVMAGSTKLAHTDDDDDAATSDKQAPKRQRFDSDSVASTYLKRMQPPKQEPRE
VLLRIYGQTHGDQMMENMITESVVFALLSERNFGPKLYGIFPGGRIEQFLPARSLATAEL
GEQRISMKVAEKLGDIHSLSIPMSKEPDWIWTCMNRWVTSFESTMKGKCLSKAKNSPVLK
KQMELLRTINYEEEIAWLKSVIEAGDYPVVFCHNDLQEGNILMRQTQQERTPRVSISSLR
SNFDETLGDSLDGNSNSNISEPERNSSKLHSVSSPPCPELDTTDDSALDSSFTIDTEPDL
IIIDFEYCAYNYRGYDLANHFIEWTFDYTNPQYPYFYHNKSNYATGQQRRDFIVQYLKSY
HDDENYSPTVKELEKVDEEIRFFTLLSHLYWSLWSIINLTSAIEFGYWEYGIARIVEYQQ
LKSDYLSK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatttgtttactgtgtcagtccaacaaagagccaaagaggaagacgatgtccaac
aacctgcaaaaggccaccctcgaggaaattcgttacgcggcggcacgcatctgccgggac
catttaaatggacgctggaaaacggtggctcctgaagatttgattgtgaaacgggtcagt
gggggattgtcaaactttttatattacgtaagtttgcccgcattcatcgaatatgaagag
gaggaggtggagcagttgctgctacagaaacagcaacaaatcgagggaagtgtcaacggc
aaagacgtcatatccactagcgagtcgggaaacagcccggtttatgcacgcgacgatgat
gaggttgagaccaagtcagtgggcgtgatggctgggagcaccaaattggctcacaccgat
gatgatgacgacgcggccacgagcgacaagcaggcaccgaaacgtcagagattcgatagc
gatagcgtcgcctcgacctatttgaaacgaatgcagccccccaaacaggaaccccgtgag
gtcctgctgcgcatctatggacagacccacggcgatcaaatgatggagaacatgatcacc
gaatcggtggtgtttgccctgctcagtgagcgcaactttgggcctaaattatacggaatc
tttccgggtggacgcattgaacagtttctaccagcgcgttcattggctaccgcggagttg
ggtgagcaacggatatccatgaaggtggccgagaaactgggcgatatccacagcttgagc
atacccatgtcgaaggagcctgactggatttggacctgcatgaaccgctgggtcaccagc
ttcgagagcaccatgaagggcaagtgcctatcaaaagccaagaactcaccggtcttgaag
aaacaaatggaattgcttcgcaccataaactatgaggaggagatcgcctggctgaaatcg
gttattgaagccggcgattatccggtggtcttctgccacaatgacctgcaggagggcaat
atattgatgcgccagacacagcaggagcgcacgcccagagtgtcaataagtagcttgaga
tccaactttgatgagaccctgggagatagtctggatggaaatagcaacagcaacatctcc
gagccggagagaaacagtagcaagttgcacagcgtttcgtcgcccccatgcccggagttg
gacactacggatgattcggcactggactctagcttcaccatagatactgagccggatctc
attatcattgactttgagtactgtgcctacaactatcggggctacgatctggcgaatcac
tttatcgagtggaccttcgactacaccaatcctcaatacccgtacttctatcacaacaag
agcaactatgccactggccagcagcgcagggattttatagtccaatatctaaagtcgtat
cacgacgatgagaactacagtcccacggtcaaggagctggagaaggtggatgaggagatt
cggttttttactttgctgtcgcatctatactggagtctctggtcgattattaacttgact
tcggcaattgagttcggttactgggaatatggcatcgctcgaattgtggaatatcaacag
ctcaagtccgactatctatcaaaatga

DBGET integrated database retrieval system