KEGG   Drosophila ananassae: Dana_GF14516Help
Entry
Dana_GF14516      CDS       T01059                                 

Definition
GF14516 gene product from transcript GF14516-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dana_GF14516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 678 aa AA seqDB search
MASEQIIEEAAEAVAGGNEPFLGLLDIALLAVLIGGAAFYFLRSRKKEEEPVRSYSIQPT
TVSTTTATDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEEC
DMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITNGDVDLTGLNYAVFGLGNKT
YEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGGG
EEVLIRQYRLLEQPDVQPDRIYTGEIARLHSVQNQRPPFDAKNPFLAPIKVNRELHKGGG
RSCMHIELSIEGSKMRYDAGDHVAMYPINDKGLVEKLGQLCNADLDTIFSLINTDTDSSK
KHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKYQ
SWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSGKLHPTDVHVTAVLVE
YKTPTGRVNKGVATTYLKNKQPKDGEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLAP
FRGFIQERQHLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQA
SKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADAV
QYIKKMEAQKRYSADVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaataattgaggaagcggccgaagccgtcgccggcggaaacgagccc
ttcctgggtctccttgacatagccctgttggcggtgctgatcggcggagctgccttctac
tttttgagaagccgcaagaaggaggaggagcccgttcgcagttattctatccagcccaca
acagttagtaccaccactgccacggataactccttcataaagaaactcaaagcctccgga
cgtagtctggtcgtgttctatggctcccagaccggaactggtgaggagttcgctggtcgc
ctcgccaaagagggtattcggtaccgtctcaagggcatggttgccgatcccgaggagtgc
gacatggaggagctgctgcaactgaaggacatcgacaactcattggccgtattctgcctg
gcgacatatggtgagggagatcccaccgacaacgccatggagttctacgaatggataacc
aacggcgacgtcgacttgactggacttaattatgcggtctttggactcggtaacaaaacc
tacgagcactacaacaaggtagccatctacgtcgataagcgcctggaggaattgggagcc
aaccgtgtcttcgagctgggactcggcgatgatgatgccaacattgaggatgacttcatc
acctggaaggatcgtttctggcctgccgtctgtgaccacttcggcattgagggtggcggc
gaggaggtgctcattcgtcagtatcgtctgctggagcagccggacgtgcagcccgatcgc
atctacactggcgagatcgcccgcctccactcggtccagaaccaacggccgccgttcgat
gccaagaaccccttcttggcgcccatcaaggtcaatcgcgagctgcacaagggaggtggc
cgctcttgtatgcacatcgagctgagcatcgaaggctccaagatgcgctacgacgctggc
gaccacgtggcaatgtatcccatcaacgacaagggtctggttgagaagcttggccagctg
tgcaatgctgatctggacactattttctcgctgatcaatacggacacggacagcagcaag
aagcatccattcccttgtccaaccacttaccgtaccgctttgactcactacttggaaatt
accgccattcctcgcactcacattctcaaggagttggcggagtactgcacagacgagaag
gagaaggaattgctgcgcagcatggcttccattagtccagaaggtaaggaaaagtaccag
agctggatccaggatgcctgccgcaacattgtccatattctagaggacatcaagtcatgc
cgtcctcccatcgaccatgtttgcgagctgctgccccgtttgcagccacgttattattcg
atctcgtcgtcgggtaaactgcatcccacagacgtccatgtgactgccgtgctggtggag
tacaaaacacccacgggtcgcgttaacaagggcgtggccaccacctacctgaagaacaag
cagcccaaggatggcgaggaggttaaggtgcctgttttcatccgcaagtctcagttccgc
ttgcccacgaaacccgagaccccgatcattatggttggtccgggtactggtctggcgcct
ttccgcggcttcatccaagagcggcagcacctgcgggatgagggaaaaactgtgggagag
tcgattctctacttcggctgccgcaagcgcagcgaggactacatctacgagtccgagctg
gaggagtgggtcaagaagggaactctcaacctgaaggccgcattctcccgcgaccaggcg
tcgaaggtttatgtgcagcatctgttggagcaggacgccgatctgatatggaacgtgatt
ggagaaaacaagggacacttttatatttgcggggacgccaaaaacatggctgtggatgtt
aggaacattttagtgaaaattctctccaccaaaggtaacatgagtgaggccgatgccgtg
cagtatatcaaaaagatggaggctcagaagcgctattccgccgatgtttggagctaa

DBGET integrated database retrieval system