KEGG   Drosophila ananassae: Dana_GF14631Help
Entry
Dana_GF14631      CDS       T01059                                 

Definition
GF14631 gene product from transcript GF14631-RA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dana_GF14631
    1.3.1.94  polyprenol reductase
     Dana_GF14631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 328 aa AA seqDB search
MAHANVGGGLGLDLETLIDRYKVNILQLIFGTFIATIAFFGGLMTFVERYLPNGIRQAFR
YGKHSFKGELDPLIAHLEVPKSWFRHFYIFAVVWSWLAFYIITSTIQSGKEAPEYVMRFL
DFVAGGRSHRKVETDSTTALVGTIMLTLQCTRRFYETNFVQIFSKQSKINLSHYAVGYAH
YFGTVIALISNTAGFVRGSQPIEFTIDNLTGQQILYLIVFGLAWQQQYSSNMILVNLRTD
PRTGRVKTEKHLVPKGGLFNVISSPHMSLEIVMYFCIADLFMPVRIWRLIFLWVASNQTI
NALLTHRWYQETFRDYPKNRRAIIPFLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgccaacgttggaggcggtcttggtctcgatctagaaaccctgatcgaccga
tacaaggttaacatactccaactaattttcggcactttcatcgccacgatcgccttcttc
ggaggattgatgacctttgtggagcgctatctccccaatggcatacgtcaggcgttccgt
tatggcaagcacagcttcaagggtgaactggatccgttgatagcccacctggaggtgccc
aagtcatggttcaggcacttttacatcttcgccgtggtctggagctggctggccttctac
atcattacatcgaccatccagtcgggaaaggaggcacctgagtatgtcatgcggtttctg
gactttgtagccggcggccggagtcaccgaaaagtagagactgactccaccaccgctctg
gtgggcactattatgctgactctgcagtgcacccggcgtttctatgagacgaactttgtg
cagatcttctcgaagcagagtaagattaacctatcccactatgcagttggttatgcccac
tactttggcaccgttatcgcattgatatcgaacaccgccggctttgtgcgcggctcccag
cccatcgagttcaccatcgacaacctgacgggccagcaaatactctacctcatcgtcttt
ggcctggcctggcagcagcagtactccagcaacatgatactcgttaatctgcgaacagat
ccacgcaccggtcgggtgaagaccgagaagcatctggtgcccaagggtggactcttcaat
gtcatatcatcaccgcatatgtcactcgagattgtaatgtacttctgcatcgctgatctc
ttcatgccggtgcgcatttggcgactcatcttcctgtgggtggctagcaaccaaaccatt
aatgctctgctaacccaccgctggtaccaggagacattccgagattatcccaaaaataga
cgggccatcattccgttcctgctctga

DBGET integrated database retrieval system