KEGG   Drosophila ananassae: Dana_GF14719Help
Entry
Dana_GF14719      CDS       T01059                                 

Definition
GF14719 gene product from transcript GF14719-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dan  Drosophila ananassae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dan00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 599 aa AA seqDB search
MEKRSDVAGNSSKFRKLSDADIAEVQLNNLDSNPKDEIEIGSTNSTEIARFNGSPEQAQR
WFTSRFFIFSVIFSCLLITAMCIGFVVHYAKSGDVGDMDTVSYWPVKLPPEQQEWYDRGI
NELKKAVSREFNRRRAKNVILFVGDGMGPNTVTAARIYGFKEEGLLAWENFPHMGLLKTY
CADKQVPDSFSTGTALFGGVKVNYETGGVDANVPLGNCTASQNEDHHVQTILKWAQVDGM
RTGFVTTTRVTHATPAALYAHVPDRRWECETGMKPEDRAQGCMDIARQLVENPTGQRINV
IMGGGRQMLVSNVTDSAADPLDTWASKSGDGRDLIRDWRQLKEAEGVSHAVVQNNRELWN
LNGENTDYVLGIFANGHLMYDHERDRSEAGMPSLSNMTLKAMEVLGNSDKGFLLVVEAGL
IDQAHHRGKARKALHEVLELNTAVETTLNFLKSTDRLDETLVVVTADHSHSLTINGHPER
GSSILGLAGKSKTEDTPYTTLTYGTSYQGFQVDPETQKRKNPTEEDITDWEYTQQAAINT
DENLHGGSDVTIHAEGAMSYLFHGVHEQSYVAHAISYALRIGRFRDSSIAETLAELTPL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagaagtgatgtggccggtaacagctcgaaatttagaaagctcagcgatgcg
gatatagccgaagtgcagcttaataatctggactccaatccgaaggatgagatcgaaatt
ggaagtaccaacagtacggagatcgccagattcaatggcagtccggagcaggctcagaga
tggtttacatcgaggttctttatcttctccgtgatattctcgtgcctcctgatcaccgcc
atgtgcatcggattcgtggtccactacgccaagagtggcgatgtgggggacatggacacc
gtcagctactggcccgtcaagctgcccccggagcagcaggagtggtacgatcggggcata
aacgagctgaagaaagcagtgtcccgggaattcaatcgacgtcgggccaagaatgtaatc
ctttttgtgggcgacggtatgggcccgaatacggtgaccgctgcccggatctacggattc
aaggaagagggtctccttgcctgggagaacttcccgcacatgggtctgctgaagacctac
tgtgccgacaagcaagttccggactcattctccacgggcacggctctcttcggcggagtc
aaggtcaattacgagactgggggagtggacgccaatgtcccgctgggaaactgcaccgcc
tcccagaacgaagaccatcatgtccagaccatactgaagtgggcccaggtggacggaatg
cgaacaggatttgtgaccactacccgggtcacccacgccactccggcagccctctacgcc
catgttcctgatcgccggtgggagtgcgagacgggaatgaaaccggaggacagggctcag
ggatgcatggacatagcccgtcagctggttgagaatcccacggggcagcggattaacgtc
atcatgggtggaggtcgccaaatgttggtttccaacgtcactgattccgctgccgatcca
ctggacacgtgggccagcaaatccggagacggacgtgatctcatccgggattggcggcag
ctcaaggaggcggaaggggtgtcccatgccgtggtgcagaacaacagggagttgtggaat
ctcaatggggaaaacaccgactacgtcctggggattttcgccaacggacatctcatgtac
gaccatgagcgggatcgcagcgaggccggcatgccgtctctgtccaacatgaccctgaag
gccatggaggtcctgggcaacagtgacaaaggattcctgctggtggttgaggctggactg
atcgatcaggcccatcacagaggaaaggcccggaaagcactccacgaagtcctggaactc
aatacggcagtggagaccactctgaactttctgaaatccacggatcggttggatgagaca
ctggttgtagtgactgccgatcattcgcacagtctgaccataaacggccacccagaaaga
ggctccagcattctgggacttgccgggaaatccaagacagaggacaccccctacaccacg
ctcacctacggcaccagctaccagggcttccaggtggatccggaaacgcagaaacgaaag
aatccaacggaggaggacatcaccgactgggagtatacccagcaggcagccatcaacacg
gacgagaatctccatggcggctcggatgtcaccatccatgccgagggcgccatgtcctac
ttgttccacggagtccatgagcagagctacgtggcacacgctatatcctatgccctgcgg
atcggtagattccgggacagctccatcgccgagaccttggcggagctgacgcctttgtag

DBGET integrated database retrieval system