KEGG   Drosophila ananassae: Dana_GF14769Help
Entry
Dana_GF14769      CDS       T01059                                 

Definition
GF14769 gene product from transcript GF14769-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dan  Drosophila ananassae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dan01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dan00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dan04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 165 aa AA seqDB search
MRLAHLLLVVVASCSIISCSLGYRPVVILHGILSGAESMTLLVQEILAAHPGTIVYNCDK
FNGWYSLENAWRQVDQIRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPDHNVKTFI
SLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYPGGAVHLRRWLLE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttgcgcatctgctgctggtagtagttgcatcctgctcaattatatcctgtagc
ctgggatacagaccggtcgtgattctgcatggaattctatccggggccgagtccatgacc
ttgttggtgcaggaaatcttagcggctcatcctggtactattgtttacaactgcgacaag
ttcaacgggtggtacagtctggagaatgcgtggcgtcaagtcgaccagattcgggactac
ctcaatgaagtcggaaaactgcatcctgagggaatcattgttctggggtactctcaaggt
ggccttttggcccgggcagccattcagagcctcccagaccacaatgtgaaaaccttcata
tccctctcttccccacaagcggggcaatatggaacaagctttttgcaccttatttttccc
gatctggcggccaagactgccttcgagctgttctacccgggcggggcagtacacctccgt
cggtggctactggaatga

DBGET integrated database retrieval system