KEGG   Drosophila ananassae: Dana_GF14774Help
Entry
Dana_GF14774      CDS       T01059                                 

Definition
GF14774 gene product from transcript GF14774-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dan  Drosophila ananassae
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF14774
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF14774
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dana_GF14774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 422 aa AA seqDB search
MRLRHSGILLGLLVATFLAPAECFWPWHTTSTTPPPPPPPSEPKISPVIFVPGDGGSQLN
ARLNKTNSPYFVCEKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKATRTTHNTPGVET
NIPGWGDPEVVEWIDPTRNSAGAYFKDIANVLVDLGYVRKMNIHGAPYDFRKAPNENKQF
FIDLKQLVEDTYEANNQSAVTFISHSMGSPMTLIFLQEQTLAWKNKYVRRQISLAGAWAG
SFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLATTPTRNYTM
AQLKEFFNDIDYMTGWEMRKDTLRYSKNFNPPDVELHCLYGDGIDTVERLQYKKSAIADE
TPKLIMGLGDGTVNQRSLRACQYWSGYSSAPVSTLALQGVDHMKILSNGDVLKYVRTVMQ
QP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccgacactcgggtatccttctggggctactggtggccacttttttggcacca
gctgaatgcttttggccttggcacacaactagcacaactcctcccccaccacccccacct
tctgagccaaaaatatcgccagtgatttttgtgcctggtgatggaggatcccagctgaac
gcccgtctgaacaaaaccaactcgccgtacttcgtgtgcgagaaaacgcacgactggtac
aatctgtggctggacctggagcaactggtcattcccatggtctactgctggatcgacaac
gtcaagttgtactacgacaaggcaacaaggacgacgcacaacacacccggcgtggagacc
aatatacctggctggggtgatcccgaggtggtggagtggatcgatcccacaagaaacagc
gccggagcctacttcaaggacatagccaatgtactggtggatctgggttacgtccgcaaa
atgaacatccatggcgcgccatatgacttccgcaaagcgccaaatgaaaacaagcaattt
ttcattgatctcaagcaactggtggaggacacatacgaggcgaacaaccaatcggccgtc
actttcattagtcacagcatgggcagtcccatgacgcttatcttcctgcaggagcagacg
ctggcttggaagaacaagtacgtgcggcgccagataagtctggcgggggcctgggcgggc
agtttcaaggcggtgaaggtgtttgccatgggcgacgaccttgactccttcgcgctcagt
gccaagatccttaaggccgagcagataacgcatccctcgaccgcctggctgctgccgtcg
ccgctgttctggaagccgtccgaggtgttggccaccacacccacgcgcaactacacgatg
gcacagctgaaggagttcttcaatgacatagactatatgactggctgggagatgcgaaag
gacacgttgcgctactctaagaatttcaatcccccagatgtagagctacattgcctctat
ggggatgggatagacacggtggaaaggttgcagtacaaaaagtcggctattgccgatgag
acacccaagctgatcatgggcctcggcgacggaacagttaaccagcgatccttgcgagcc
tgccagtattggtcgggctactccagcgcgcctgtgtccacgctggccctccagggcgtg
gaccacatgaaaatcctgtccaacggggacgtcctcaagtacgttcgcaccgtcatgcag
cagccgtag

DBGET integrated database retrieval system