KEGG   Drosophila ananassae: Dana_GF14873Help
Entry
Dana_GF14873      CDS       T01059                                 

Definition
GF14873 gene product from transcript GF14873-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dana_GF14873
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dana_GF14873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 780 aa AA seqDB search
MASGGLSDREREEIVRTLTRDVQSLKEMVQCRESELVKLHREIHKLKSVLQQTTNHLNVT
RNERHHSPKSKLYSLPEQCDEEETASGRDPHVCVSCGMALPTSPEYALEALTLDPLPIAS
IFSTRSPSSSKSGGLDESPPLQPKPMPAATKKQGVSAESCVQSMQQSYSMPIPKYEKDYS
DKQQIKDAVMDNDFLKNIDASQVRELVDSMYPKSIAAGEFVIREGEVGAHLYVSAAGEFA
VMQQGKVLDKMGPGRAFGELAILYNCTRTASIKVLSEAARVWVLDRRVFQQIMMCTGLQR
IENSVNFLKSVPLLRNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDTFFLISQGNVRV
TQKLAASSTEETELRTLARGDYFGEQALINEDKRTANIIALPPGVECLTLDRDSFKRLIG
DLCELKEKDYGDESRMLAMKQAEGGSQAAEQPKTSRAEMEFPDLKLTDLEVVSTLGIGGF
GRVELVKAYQENRVDTFALKCLKKRHIVDTKQEEHIYSERHIMLSSKSPFICRLYRTFRD
EKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENL
MLDERGYVKIVDFGFAKQIGVSAKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHE
LLNGAPPFSAPDPMQTYNLILKGIDMIAFPKNISRWAVQLIKRLCRDVPSERLGYQTGGI
QDIKKHKWFLGFDWDGLSSQLLIPPFVRPIAHPTDTRYFDRFPCDPSEPPDELSGWDADF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggggggattgagcgaccgggagcgggaggagatcgtccgcaccctcaccagg
gatgtgcagtccctcaaggagatggtgcagtgccgggagagcgagctggtcaagctgcac
cgggaaatccacaagctgaagagcgtgctgcagcagaccaccaaccatttaaacgtgacc
cggaatgagcggcaccactccccaaagtccaaactctactccctgccggagcagtgcgac
gaggaggagactgcctccggtcgggatccccatgtgtgcgtctcctgtggcatggcgctg
cccacgagtccggagtacgccctggaagccctgacgctggacccgcttcccattgcttcg
atattctcaacccgctcgccctcgtcttccaagtctggaggactggacgagtctcctcct
ttgcagccgaaacccatgccggcggccaccaagaagcagggagtctccgccgagagctgc
gtccagtccatgcagcagtcctacagcatgccgattcccaaatacgaaaaggactacagc
gacaagcagcagatcaaggacgccgtgatggacaatgacttcctgaagaacattgacgcc
tcgcaggtgcgcgagctggtggactccatgtaccccaagagcatagccgccggcgagttt
gtgatccgcgagggcgaggtgggagcccacctgtacgtctccgccgccggagagtttgca
gtgatgcagcaggggaaggtgctggacaagatgggccctggccgggcctttggggagctg
gccattctctacaactgcacccgaacggcctccattaaggtgctcagcgaggcggccaga
gtctgggtgctcgaccggcgggtcttccaacagatcatgatgtgcacgggactccagcgc
attgagaacagcgtgaacttcctgaagtcggtgcccctgctgaggaacctcagcgaggag
ctgctagcgaagattgcggacgtcctggaactggagttctacgccgcgggaacctacatc
atccgccagggcaccgccggcgacaccttcttcttgatctcccagggcaacgtccgggtg
acccagaagctggcggcgagttccacagaggagacggagctgcgcaccctggcccggggc
gactacttcggggagcaggctctgatcaatgaggacaagcggacggcgaacatcatcgcc
ctgccgccgggcgtggagtgcctcaccctggacagggactcgttcaagcgcctgatcggg
gacctctgcgagctgaaggagaaggactacggggacgagagccgcatgctggccatgaag
caggcggagggcggcagccaggcagccgagcagcccaagacctcgcgggcggagatggag
tttcccgatctgaagctgacggacctggaggtggtcagcaccctgggcattggtggcttt
ggacgcgtggagctggtcaaggcgtaccaggagaacagggtcgacaccttcgccctgaag
tgcttgaagaagcggcacatcgtggacaccaagcaggaggagcacatctacagcgaacgg
cacatcatgctcagctccaagtcgccgttcatctgccggctgtaccgcaccttcagggac
gagaagtacgtctacatgctgctggaggcctgcatgggcggcgagatctggacgatgctc
cgcgaccggggctccttcgaggacaatgcggcgcagttcatcatcggctgtgtcctgcag
gcgttcgaatacctccacgcccggggcatcatctaccgcgacctcaagcccgagaacctg
atgctggacgagcgcggctacgtgaagatcgtggactttggattcgccaagcagatcggg
gtgagcgccaagacctggacgttctgcggcaccccggagtacgtggcgccggagatcatc
ctgaacaagggccacgaccgcgcagtggactactgggccctgggcatcctaatccacgag
ctgctcaacggagctccccccttcagcgcccccgatcccatgcagacgtacaacctcatc
ctgaagggcatcgacatgatcgccttccccaagaacatatcccgctgggccgtgcagctc
atcaagcggctctgccgggatgtgccgtcggagcggctggggtaccagaccggaggcatt
caggacattaagaagcacaaatggttcttgggcttcgactgggacgggctgtccagccag
ctcctaatcccgccattcgtccggcccatcgcccatccgacagacacccggtacttcgac
cgcttcccgtgcgatcccagtgagccgccggacgagctatccggctgggatgcggacttt
tag

DBGET integrated database retrieval system