KEGG   Drosophila ananassae: Dana_GF14918Help
Entry
Dana_GF14918      CDS       T01059                                 

Definition
GF14918 gene product from transcript GF14918-RA
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF14918
   00052 Galactose metabolism
    Dana_GF14918
   00500 Starch and sucrose metabolism
    Dana_GF14918
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dana_GF14918
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dana_GF14918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 290 aa AA seqDB search
MESLRLLVMETYSSLLDRELCINEWAQERLSFAEPFWRFMSIYLEPSVLFNLLIPLSGIY
SQELLTHLLSAVTLVSTLNSFEKWIYPEMRPLWWLREQYAKGQVLNKPQVALESNNLSCE
TSGGLPCAHSMTFTVFILILASFFFVHCWQRYVYWRSSVWRFFLYPVIVGVVVCMWLSRL
YLATEFLHQCVLGSYFGIRALNCFEGNIKYLYSRRRRNAVVVVTILGGIAVGVYFLKLRL
SIDPHWSVREAFKWCPEATYMRHEASPIFVLTRDLGNLMGVALASPLSKQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctcagactgctggtaatggaaacctatagtagcttactcgatcgggagctt
tgcatcaacgaatgggcacaggagcgattaagttttgcggagccattctggcgatttatg
agcatatatctggagccaagcgttctttttaatctcctcatacccctatctggcatctac
agtcaggaactactcacacacctgctctcggcggttactctggtcagcactttgaactcc
tttgagaagtggatctatccagagatgcgtcccttgtggtggctcagagagcagtatgcc
aaaggccaggttctaaacaagccgcaagttgctttggaaagcaataacctgagctgtgaa
accagcggagggcttccctgtgcccactcgatgactttcacggtttttattctcatccta
gcatcttttttcttcgttcactgctggcagagatatgtatactggcgttcctccgtttgg
cgtttctttctgtatcctgtgatcgttggagtggtggtctgcatgtggctaagccggctc
tacctggccaccgaattcctacaccagtgcgttctgggcagttacttcggcatcagagcc
ttgaattgcttcgagggaaacataaagtacctatactccaggcgacgacgaaacgctgta
gtggttgttaccatattaggaggaatcgctgtaggagtttattttctaaagctgcgtctt
agcatcgatcctcattggtcagtgagagaggctttcaaatggtgccccgaagccacgtac
atgcgtcacgaggcaagtcctatattcgtgcttacacgagatttgggaaacctaatggga
gtggctttggcgtcccccctatcgaagcagtaa

DBGET integrated database retrieval system