KEGG   Drosophila ananassae: Dana_GF15299Help
Entry
Dana_GF15299      CDS       T01059                                 

Definition
GF15299 gene product from transcript GF15299-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF15299
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dana_GF15299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 227 aa AA seqDB search
MSTWTPLESNPEVLSKYIHKLGVSPSWSVTDVIGLEEETLAWIPRPVKAFILLFPISETY
EKHRAEEHERVKLADEQHPGDLFYMRQFTHNACGTVALIHSLANNKDVAIESGVLKNFLE
KTASLSPEERGQALEQDKDFTADHQALAQEGQTNAADHEHVIHHFISLVNKEGTLYELDG
RKSFPIKHGPTSDETFVKDAANVCKEFMARDPSEVRFTVLALTAAQD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctggacaccattggaatccaaccccgaggtgctgtctaagtacatacataaa
ttgggcgtgtcgccatcctggtcggtgactgacgtcatcggattggaggaggagactctg
gcttggattcctcgtcccgtgaaggcttttattctactctttccaatcagcgaaacctac
gagaaacaccgtgccgaagagcacgagcgcgttaagctggcagatgagcagcaccccggc
gatcttttctacatgcgccagttcacccacaatgcctgcggcacagtggccctcatccac
agcctggccaacaacaaagatgtcgctattgaaagtggagtcttgaagaacttcctggag
aagactgccagcctgtcgccggaggagcgtggacaggctttggagcaggataaggacttc
acggccgatcatcaggccctggctcaggagggacaaactaatgctgccgaccatgagcac
gtcatccatcactttatctcattggttaacaaggagggaactctatacgagctcgatggt
cgcaaatccttcccgattaagcatggcccgacttcggacgagactttcgttaaggatgca
gccaatgtgtgcaaggagttcatggctcgcgatccttccgaggtgcggttcactgttttg
gctttgactgctgcccaggattag

DBGET integrated database retrieval system