KEGG   Drosophila ananassae: Dana_GF15322Help
Entry
Dana_GF15322      CDS       T01059                                 

Definition
GF15322 gene product from transcript GF15322-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dan  Drosophila ananassae
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dana_GF15322
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dana_GF15322
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dana_GF15322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MFAIPLRQPSSMSKSQKQSSSMDDHDKPFQYEITDHGYGKDAVKVLHVSRKGPVHTIQEY
EVGTHLKLYSKKDYYQGNNSDIVATDSQKNTVYLLAKKHGVESPEKFAILLAQHFLNKYS
HVEEAHVHVEAYPWQRVCQDETKANANGLAPVGNQGSCNFSSIDNRSLHNHAFIFTPTAQ
HYCDVVARRTDPKQTVITGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCSW
EYSSTDNLDFLRAWQTVKNIILRNFAGDPQVGISSPSVQHTLYLSERQVLDVLPQVSVIS
MTMPNKHYFNFDTKPFQKIAPGDNNEVFIPVDKPHGTIYAQLARKNINSHL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccattcccttgagacagcccagctccatgagcaagagccagaagcaatcctcc
agcatggatgaccacgacaaaccgtttcagtatgagattacggatcatggttatggcaag
gatgcggtgaaggtgttgcatgtgagtcgcaaaggaccagtgcacaccatccaggagtac
gaggtgggcacccacctgaagttgtacagcaagaaagactactaccagggcaacaactcc
gacattgtggcaactgattcccaaaagaataccgtctacttgctggccaagaaacacggt
gttgagagtcccgaaaagtttgccattcttctggcccagcactttttaaacaaatattct
cacgtggaagaggctcatgttcatgtggaggcttatccttggcagagagtttgccaggac
gagaccaaggccaatgccaatggcctggcaccagttggtaaccagggctcctgtaatttc
agttccattgacaaccgatccttgcacaatcatgcctttatttttaccccaactgcccag
cattattgtgatgtagttgccaggaggacagatcccaagcaaacagtgatcactggtatt
aagggacttcgggttctgaagacgacccaatcctcgtttgtaaactttgtgaatgatgag
ttccgatctctgccagatcaatatgaccgcatcttcagcacagtggtggactgctcctgg
gagtactccagtaccgacaatttggactttttacgtgcctggcaaactgtaaaaaatatc
atcttacgtaactttgccggtgatccacaggtgggcatttcttcgccctccgttcaacac
acactgtatctgagtgagagacaggtcctggatgtcctgccacaggtttccgtaatctca
atgactatgccgaataagcattatttcaatttcgatacaaagcccttccaaaaaatcgct
cccggtgataacaacgaagtattcattcccgtggacaagccacatggcaccatctacgct
caactggcccgaaagaatatcaacagtcatctataa

DBGET integrated database retrieval system