KEGG   Drosophila ananassae: Dana_GF15363Help
Entry
Dana_GF15363      CDS       T01059                                 

Definition
GF15363 gene product from transcript GF15363-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dan  Drosophila ananassae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dan00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:dan00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dan00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dan00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dan00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dan00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dan00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:dan00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 537 aa AA seqDB search
MKKFTGIVLLFTILLSMEAPSCDGANILGIFGSHSPSHVIVHMAMMKTLADRGHNITVVT
QMKPKLKAHENITVVLAPPTPEREKYIKEYMSQITAEKPSIWTTFFKAIVKSGDQFEAQY
EFAVHPNFKEIYENPHTKFDLVFLGMMGNDFQLGVAAKLKCPVIMTWVGVPIQILDSIVG
NVADPAFVPSLNVALEPGQITMRFGQRLLNFFKHSFLKLLNVLMNYKMNEFYERAFGNES
DPDFPTYAEVKRRVSLLFYNYHAPSEGPIRPVVPQSIEIGGIQVKEQPDPLPKDIAEFLG
NATDGAIFFSLGTNVDTNTFSPKVFEIIYKVLSKLPQRVIWKWQDLNNKPGNASNIYFGN
WLPQDDILAHPNTKLFITHAGKGGVAESQFHGVPMVALPLFADQQGNAEILTTAGFGRWL
EILTLTEDELESTIKDVLENPTYREAIGKFSSLYRDRPLTARQSVIYWTEYVLRHQGAYH
LQSPEIHLDFVARNNIDVYGVVLLVNLISFLIFLVIVRWVFRKVLKCFTKSNKSKTD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcacgggaattgtgctactttttaccatactcctgagtatggaagctccc
agttgcgatggagctaatatattgggaattttcggctcccatagcccctcgcatgttatt
gtgcacatggctatgatgaagactttggcggatcggggtcacaacatcaccgtggtgacc
caaatgaaacccaaactcaaggcgcatgaaaacatcaccgtcgtcctggcgccacccact
cccgaacgcgaaaaatacattaaggaatatatgtcccaaataactgccgagaaaccaagc
atttggacaacattttttaaggcaatagtgaagtctggtgaccagtttgaagcgcaatac
gagttcgcagttcatccaaatttcaaggagatctacgaaaatccacatacaaaattcgat
ctggtatttctgggaatgatgggcaatgattttcaactgggcgtggcagcaaagctaaag
tgtccggtgattatgacatgggtgggtgttccgatccaaatactagattccatcgtggga
aatgttgccgatccggcctttgttcctagtttgaatgtggccctggaaccaggacaaatc
accatgagatttggccaacgattgctaaacttttttaagcactcatttctgaaattattg
aacgtcctcatgaactacaagatgaatgagttttatgagcgagcttttggaaatgaatcc
gatcctgattttccaacttatgctgaagtgaaacgacgtgtttccctactcttctacaac
tatcatgctcccagtgaaggacccattcgccctgtggttcctcagtccattgaaatcggt
ggaattcaggttaaggaacagccagatcctctgcccaaggacatagcagagttcctggga
aatgccacagatggagccattttcttcagtctgggcactaacgtggacaccaataccttt
agtcccaaagtgtttgagattatctataaggttttgtccaagctgccccagcgggtaatt
tggaagtggcaggatttgaacaacaagccgggcaatgcttccaacatttactttggcaac
tggctgccccaggacgatatcctggcgcatcccaatacaaaactatttattacccatgcg
ggcaaaggaggcgtggcggagtcacagttccatggagttccaatggtggcattgccactt
tttgctgatcagcagggaaatgctgagatcctgaccactgccggatttggaagatggctg
gaaattcttaccctgacagaggatgagctggaatcgactatcaaggatgtgctggagaac
ccaacctaccgagaggctattggaaaattctcctccttgtacagggatcgtccgcttaca
gctcgtcaatcagtaatttattggacggagtatgttctgcgtcatcagggagcctatcat
ctccagagtccagaaattcatttggattttgtagctcgaaacaacatcgacgtgtatgga
gtggttttgttagtcaacttgatttctttcctcatatttctggtcatagtgcggtgggtg
tttcgaaaggtattgaaatgctttacaaaatcaaataaatcaaagaccgattag

DBGET integrated database retrieval system