KEGG   Drosophila ananassae: Dana_GF15369Help
Entry
Dana_GF15369      CDS       T01059                                 

Definition
GF15369 gene product from transcript GF15369-RA
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
dan  Drosophila ananassae
Pathway
Glycerolipid metabolism
Retinol metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dan00561]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dan00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 570 aa AA seqDB search
MTTNKDPQVKGAVKTEETTNGGTGGIIKRLRRSASATEHNLSNLRNRKSTQNLFDQHGNP
IDLRQYRKVLDKDENGNGMNGSEKKLRYRRTQSVTRAEEISNKEEKQRRAQPGRPIHRPR
DSLFSWSSGFTNFTGLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEGEG
YNALILSIYSLVHISLCLAVEKGLAMEIIAEGLGIFIQIVNIIVLVCLPVVSIHLRGHAF
SLMGASTVCFYYSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKNGALDGGDE
DEAIPKLVQYPDNLTYRDLVYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGANVVM
ALFQQWIIPSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELL
NFADRNFYCDWWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAF
FHEYLVSVPLQTYKIWAFMGMMGQIPLSAISKYIEKRLGPRMGNIIVWASIILGQPLCIM
AYYHDYVVHHFKSALNGTDYTSQIFKMNYN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaacaaggatccccaagtcaagggggccgtcaaaacagaagagaccacaaat
ggcggaactggagggatcatcaaacgcctcaggagatccgcctccgccacggaacacaat
ctcagtaacctgaggaatcggaaatccacccagaacctattcgatcagcatggcaatccc
atagatctgcggcaataccggaaagttttggacaaggatgagaacggaaatggtatgaac
ggaagtgagaagaaactgcgctacagaaggacccagagtgtcacgagggctgaagagatc
tccaacaaggaggagaaacagcgaagagctcaacctggcagaccgatccatcgtcctaga
gactcactgttctcctggagctcagggtttaccaactttacgggactggtcaactggggg
tttctgctactctgcattggaggtctacgtctgggtctggagaatctactcaaatatggc
attcgcattaatcccctggactggttcttcttcatcagtggccacaacgaaggcgaaggt
tacaatgccctcatcttgagcatttattccctagtccatatatccctctgtctcgctgtg
gagaaaggcctggccatggaaattattgccgaaggactgggcatcttcattcagattgta
aacataattgtgctggtctgcttgcctgtggtgagcatccatcttagaggtcatgccttt
agtttgatgggagcttctacggtttgcttttattactcggtcctgtttctgaagctctgg
agctatgtgcagacaaatatgtggtgtcgccagacctactaccagaagaacccccgagaa
cgcaggcccagcatcactttagcagaactgaaaaatggagccctggatggcggcgatgaa
gacgaagctatccccaagctagtacagtacccggataatctcacctacagggatctcgtg
tacttcctttgtgcccccactctgtgttatgaattgaatttcccgcgaacttcgcgcgtg
cgcaagcgcttcttgctcaagcgtctcctggaggttgtgattggagctaatgtggtcatg
gctctgttccagcagtggattattccctcagttcgcaactcgttaatcccattctccaat
atggatgttgctttggccactgagcgactccttaaactagcgttacccaatcacctgtgc
tggctgtgctttttctacctgatgtttcactcctttctgaacgcggtgggagaactactg
aactttgcggatcgtaacttttattgcgattggtggaatgccaataatattgatactttt
tggagaacctggaacatgccagtccacaggtggtgtgttcgtcacctttacatcccagtg
gttcagatgggttactcttcgcgacaggcttcaactatagtgttcctgttcagcgccttc
ttccatgaatacttggtttcagttcctctacaaacgtacaagatttgggcctttatggga
atgatgggccagatccctctttcggccatttcgaaatatattgaaaagcgtttggggccc
cgaatgggcaacattattgtttgggcctccattatcctgggtcagcccctctgcattatg
gcctactatcatgattatgtggtccaccactttaaaagcgcactcaacggcaccgactat
acgtcacagatttttaaaatgaattacaactga

DBGET integrated database retrieval system