KEGG   Drosophila ananassae: Dana_GF15415Help
Entry
Dana_GF15415      CDS       T01059                                 

Definition
GF15415 gene product from transcript GF15415-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dan  Drosophila ananassae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dana_GF15415
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dana_GF15415
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dana_GF15415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 894 aa AA seqDB search
MKLKRICALSCFNARSGNPFEDSPTSWILQYAAYYWKVSREGRRVYMDYYYMENGKQIYG
VPIGGIGGGTIGRGYAGEFCRFQMRPGIYEYNVVQANQFIVTIKDPKGCTIFQSLLSKCS
TRGSSGGGNPADPDADGEKTKCQLPNCSSRTKQPLSAWHSNIEDSRCQYTGLYPRSWTEY
DLSHYGVRLVCRQVSPVIPHEYRESSLPCAVFVWDVENVCDQERKVSITFTFKNGTGNKK
QDAEGGAESQLISEGNAKGVAIRQKIAEMPCSYNLACRVRPEISISRCPQFDPAGNGEQL
WAQLKEHGQLNEQPTPETLKTKDIGVAVCAQVALKPKASHKLEFVLAWDMPKIQFPRKLQ
THTRYYTKYFDDSGESGPKICEYALKQYPSWERLIDAWQRPILNDETLPDWYKCAIFNQL
YFISDGGTIWLKCDSFLGKELSYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHL
WPNLQVSLQYDFKDAIAADLTDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYN
IHDVNDWKDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYEMYSQDNKR
KNSSDEKKQNRKSASMYINETNGRVYLMDAIGYLKAMYASCKAIMERTIEYDKDNDGLIE
NTKMPDQTYDSWVMDGPSSYCSGLWLAALQAMSAMATILDQPNDCMRYQDILEKGKRSLE
EKLWNGSYYRFDLSHGHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVM
GFHDGNIGAANGFIANASDPSKPGHVDNSNIQSEEVWPGVVYALAATMIQEGMFEEAFQT
AGGMYKTISQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRAQRD
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaagcgcatctgtgcgttatcctgtttcaatgccagaagcggaaatcccttt
gaggactcgcccacctcctggatacttcaatatgcggcctactactggaaagtgtcgcgt
gaaggtcgtcgggtctacatggactactactacatggagaacggcaagcagatctatgga
gtgcccatcggtggaatcggaggcgggaccattggccggggctatgccggggagttctgt
cgcttccagatgcgacccgggatctacgagtacaatgtggtgcaggccaatcagttcata
gtaaccatcaaggatccgaagggttgcaccattttccagagcctcctctcgaagtgcagc
accagaggcagcagcggcggcggtaatccggcggatccggacgccgatggggagaaaact
aaatgtcaactgcccaattgcagcagtcgcaccaagcagccgctgagtgcctggcactcg
aacatcgaggactcgaggtgccagtacaccggcctctatccgcgctcctggaccgagtat
gatctctcccactacggtgtccgcctggtttgtcgtcaagtgtctccagtcataccgcac
gagtaccgcgaatcgagtctgccctgcgccgtcttcgtctgggatgtggagaacgtgtgc
gaccaggagcgcaaggtgtccatcacttttaccttcaagaacggcactggaaataagaag
caggacgccgagggcggagccgagtcccagttgatcagcgagggtaatgccaagggcgtg
gccattcggcagaagatagccgagatgccgtgcagctacaatttggcctgccgggttcgt
ccggagatcagtatctcgcggtgccctcagtttgatcccgcaggaaacggggagcagctg
tgggcccagctcaaggagcacggtcagctcaacgagcagcccaccccggagaccctcaaa
actaaggacataggtgtggctgtttgtgcccaggtggccctgaagccgaaggcctcgcac
aagctggagttcgtactggcctgggacatgcccaagatccagttccccagaaagttgcag
acccacacgcgctactacaccaagtacttcgatgacagcggcgagtcgggccccaagatc
tgcgagtatgccctgaagcagtaccccagttgggagcgattgattgatgcttggcagcgt
ccaatcctcaatgatgagaccctccccgattggtacaagtgcgctattttcaatcaactc
tacttcatctcggatggaggaaccatttggctcaagtgcgactcctttttgggcaaggaa
ctgagctatgatgatcccagactggcttacggtcgatttggctacttggaagggcatgag
tacaggatgtacaacacctacgacgtccacttctacgcctcgccagctcttgcccatctc
tggccgaacttgcaggtgagtctgcagtacgacttcaaggatgctattgctgccgacctg
accgacaccaggaagatgctgtacgatggtaaggtgatgccaaggaaggtcaagaactgt
gtcccccacgacttgggtgatccagatgaagaaccctttactctaatcaactgctacaac
attcacgatgtgaatgattggaaggatctcaataccaagtttgtgctgcaggtctaccgg
gactactacgtcctcaacgaacttgcccaggcccaggccgacaatgccagcaagttcagc
tccatcgagttcatagacaaggagagcctgtacgagatgtatagccaggataacaaacgc
aaaaattcatcggatgagaaaaagcagaaccgcaaatctgcctccatgtacattaatgag
accaatggaagggtctatctgatggacgctatcggctacctcaaggccatgtatgcctcc
tgcaaggcgatcatggaacgaaccattgagtacgacaaggacaatgatggcctaatcgag
aacaccaagatgccggaccagacctacgactcctgggtgatggatggccccagttcttac
tgctctggactctggttggccgcgttacaggccatgtcggccatggctacgattctcgac
cagcccaatgactgcatgcggtatcaggacatcctggaaaagggcaagcggtcgctggag
gagaagctctggaacggtagctactacaggtttgatttgtcgcatggtcaccgggatacc
attatggccgatcagctttgcggccattggtatctgaagtcctgcggattcgactacgag
atctatccaaaagaaaatgtccgcacggccctgaagaggatctacgacaacaatgtgatg
ggcttccacgacggcaacattggtgcggccaatggctttatcgccaatgccagcgatccc
tcaaagcctggtcatgtggacaacagcaacatccaatctgaagaggtgtggccaggtgtg
gtctacgcccttgcggccaccatgatccaggaggggatgttcgaggaggctttccaaacc
gcaggcggcatgtacaagacaatctcgcagcgcatcggcatgaatttcgaaactccggag
gctctttacggcgagaagagataccgctccattggctacatgagaccattgagcatctgg
tcgatgcaggtagctctggagaggcggcgtgcccagcgcgactaa

DBGET integrated database retrieval system