KEGG   Drosophila ananassae: Dana_GF15429Help
Entry
Dana_GF15429      CDS       T01059                                 

Definition
GF15429 gene product from transcript GF15429-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dan  Drosophila ananassae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dan00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dan00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:dan00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:dan04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 341 aa AA seqDB search
MLNIAVIGAGVNGVASAIKILEHYLKEGKTAIRVTIISEEFTPKTTGDGSAGLWGPYLLG
GTPQSKVYKWSKSMHQFLEQIWLSEDAGEAGVCLIPCIRLNTSTVEPVEDFWRDIVYGAV
NLSEDQLAAFNKGRSVKFTSGLSFVTYTSEPVKLLPYLMKRFTRKGGLIVRKKVIDLDTF
ISESEYDVIINCSGLGSRQLLGDNEMYPVRGQVSRVKANWIFSAVLDESDDGNYIIPNTE
SVVLGGTHQEGDYNEQVCPRDKKTIVDGCRRYIPGLEHTESLFDWVGLRPGRGQLRLEAE
RRGRKLVVHNYGHGGSGVTLCWGCADDVLDLILAAKVSSKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatattgcagttattggagcgggggttaatggggttgccagtgccattaagata
ctggaacactatctaaaggagggtaagactgcgatacgggtgacgattatatcggaagag
tttacaccgaaaaccaccggcgatggatcggcgggtctctggggtccctacctactgggt
ggtactccccaatccaaagtctacaaatggtcgaagagtatgcaccaattcctggagcag
atatggcttagtgaagatgccggtgaagctggagtctgtttgataccctgtatccgattg
aatacctcaactgtcgagcctgtggaagacttttggcgagacattgtctatggagccgta
aacctgtcagaggatcaactagctgcctttaacaaaggacggagtgtgaagtttacgtca
ggtctatcttttgtcacctatacctccgagcctgtcaagcttctgccctatttgatgaaa
agatttacccgtaaaggtggcttaattgtcaggaaaaaagtaatcgacttggatactttt
atctcggaatccgaatacgatgttataatcaattgttcgggtttgggctcccgacaactt
ctgggtgacaacgaaatgtatccagttcgtggccaagtatcccgtgtgaaggctaactgg
atcttttccgccgtactggacgaaagcgatgatggaaactatataattccaaatactgag
agtgtagtcctgggcggaactcatcaggagggagactacaatgagcaggtctgtcctcgg
gacaagaaaaccattgtggatggatgtcggcgctatattccgggtctggaacacacggag
agcctcttcgattgggtgggtctacggccaggacgcgggcagctccggctcgaggcagag
cgacgtggacggaagctggttgtccacaactatggacatggtggcagcggagtcactctt
tgctggggctgtgccgacgatgttcttgatctcatactggcagccaaggtttcttcgaaa
ctataa

DBGET integrated database retrieval system