KEGG   Drosophila ananassae: Dana_GF15452Help
Entry
Dana_GF15452      CDS       T01059                                 

Definition
GF15452 gene product from transcript GF15452-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dan  Drosophila ananassae
Brite
Ribosome [BR:dan03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dana_GF15452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 209 aa AA seqDB search
MLPIARGIYSGLANITRSSRGALHTASSLRCKASETAEEKDAENAEGEAGGEENQSSSSG
PDPKDRSKVIPVETSMRYLKSAAYKQTYGNDFVWTQYRRNHKGMYAPRKTRKTCIRQGRI
STGNPCPICRDEYLVLDYRNTELLEQFISPHNGNVLSYSKTGLCQKSHLRLTVAVQQARD
SGFLTYDVPFREYDYSEYYGQEQKKKDIN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgctaccaattgctcgcggaatatactctggcctggccaatataacacgtagcagccgg
ggagcccttcacacggccagttccctaagatgcaaagcttcagaaacagcggaagaaaag
gatgcagagaacgctgaaggtgaagcaggcggcgaggagaaccaaagcagctcctcagga
ccagatcccaaggatcgcagcaaggtcatacccgtagagacgtcaatgcgttatctaaaa
agcgccgcatataaacaaacctacggaaacgacttcgtgtggacgcaatatcgccgcaac
cacaaaggaatgtatgcgccccgaaaaacacgtaaaacgtgcatccgccaaggaaggatc
tccaccggcaacccctgtccaatctgtcgggacgagtacctggtgctggattaccgcaac
acggagttattggagcagttcatttccccccacaacggcaacgtgctgagctactccaag
acaggcctgtgccagaaaagccacctccgcctcacggtcgctgtacagcaagctcgtgat
tctggattccttacctatgatgtgcctttcagggagtacgattacagcgagtactacggc
caggagcagaaaaagaaggatatcaattag

DBGET integrated database retrieval system