KEGG   Drosophila ananassae: Dana_GF15600Help
Entry
Dana_GF15600      CDS       T01059                                 

Definition
GF15600 gene product from transcript GF15600-RA
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dana_GF15600
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dana_GF15600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 728 aa AA seqDB search
MLDRCEMPIQLDNDKLRRDARLSSSRLDLPQLCNGSRRLDGHNNHVAVNETSANATSLNG
NSNGNTNGHNNNNNNIGSPVSSSTTNSSSNGVNERGSSTKSNSSSGSSGNSASSTGSAEP
KCNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDD
DNGNYKIIEHDHVAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVE
ELNILDELRDKDADGSHNVIHMLDYTFFRKHLFITFELMSLNLYELIKKNNYNGFSMSLI
RRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKFYTYIQS
RFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL
ISVARRRRLFFDSRDAPRCITNTKGRKRTPGSKSLAQILHCQDRYFIDFLQRCLEWDPAE
RMTPDEAAHHEFLQPSSSSRHRSCRMSNSSSSSGLNSVSQKSSCYNFADISPGSGTGGVV
GGGPVVASITSTTAVHNAAIATTTKSRQQQAQVQSQSHTHGHAQSNGHLPEIKLSASDKY
NSMQKVAVRSKITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLNGSGVSSKY
GSSTLAHNHHNVTHHNASTATIATATHHHHHHGGAGGGQQQQSSSGATVMSHSQSTGDVS
DRAIFGRA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgccgattcagctggacaacgacaagctgcgccgggatgct
cgcctctcgagctctcgactggacttgccccagctctgcaacggctccaggcgactggac
ggacacaacaatcatgtggctgtcaatgagacctcggccaatgccacgtccctgaacggc
aacagcaacgggaataccaacggtcacaacaacaataacaacaacatcggctccccagtc
tcctcatcgaccaccaacagtagcagcaacggggtcaacgagcggggctcctccacaaag
tccaacagcagcagtggcagctccggcaactcggccagcagcacaggcagcgccgaacca
aaatgcaacacccccatgacgccatctgaactggtgaaaaagttccggaactacctaaca
gacctggagttcgaggagctgaaggtgtacaaggaggtctggtactttggccagcatgcc
agcaagaactacaacaaacccgcccccacagccaataccactaacctgggctatgacgat
gacaatggcaactacaagatcatcgagcacgatcacgtagcctttcggtatgagattctg
gaggtgattggcaaaggcagcttcggccaggtgatccgggccctggaccacaaaaccaac
acacacgtggccatcaagataatcaggaacaagaagcgcttcctcaaccaggccgttgag
gagctcaacattctggacgagctgcgggacaaggatgcggatggatctcacaacgtcatc
cacatgctggactacacgtttttccgtaaacacttgttcatcaccttcgagctgatgagc
ctgaacctgtacgagttgataaagaagaacaactacaatggattcagcatgagtctcatt
cgccggttctgcaactcgattgtgaagtgcctgcgtctgctttacaaggaaaacatcatt
cactgtgatctcaagccagaaaatatcttgctcaaacagcgaggcagcagctcgatcaaa
gtcattgactttggcagctcgtgctacgtggaccgcaaattctatacgtacatccaatct
aggttctatcggtccccggaggtgattctcggactacaatacggcaccgccatcgacatg
tggagcttaggctgcatccttgccgagctttacacgggctttccccttttccccggcgag
aacgaggtggaacagctggcctgcatcatggaggtgctgggcctgccacccaaggtgctc
atttcggtagccaggaggcgccgactcttcttcgattcccgggatgctccgcgctgcatc
accaacaccaaaggcaggaagcggacaccgggcagcaagtcgctggcacagatcctgcac
tgccaggaccggtactttattgacttcctgcagcgctgccttgagtgggatcccgcggag
cggatgacgccggacgaggcagcccatcacgagtttctgcagccctcctcctccagtcgc
catcgcagctgccgcatgtcgaacagctcctccagctccggcctgaacagtgtctcccag
aagtcctcctgctacaattttgcagatatctcgccgggcagcggaaccggcggtgtcgtc
ggtggtggtcccgtggtggcttcgataaccagcaccacggcagtgcacaatgcggcaatc
gccaccacgaccaagtcaaggcagcagcaggcgcaggtgcagtcccagagccacacccat
ggccacgcccagtcgaacggacacctgccggagattaagttgagtgccagcgacaagtac
aacagcatgcagaaggtggcggtgcgctcaaagatcacgtccagcgtctcggacttggaa
tccgtgcagcagtactccctgcaccgcatctacgggggcgtgggaagcggcagtacccac
catgtctcctcggcggccaccaggaagcacctgaacggcagcggagtgtcctccaagtac
ggcagctcaactctggcgcacaatcaccacaatgtgactcaccacaatgcatccacggcc
accattgccaccgccacgcaccaccaccaccatcacggcggggcaggcggtgggcagcag
cagcaatcgtcgtcgggagccaccgtcatgtcacactcacagtcaaccggcgatgtctcc
gacagagccatcttcgggagagcttga

DBGET integrated database retrieval system