KEGG   Drosophila ananassae: Dana_GF15600Help
Entry
Dana_GF15600      CDS       T01059                                 

Definition
GF15600 gene product from transcript GF15600-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 728 aa AA seqDB search
MLDRCEMPIQLDNDKLRRDARLSSSRLDLPQLCNGSRRLDGHNNHVAVNETSANATSLNG
NSNGNTNGHNNNNNNIGSPVSSSTTNSSSNGVNERGSSTKSNSSSGSSGNSASSTGSAEP
KCNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDD
DNGNYKIIEHDHVAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVE
ELNILDELRDKDADGSHNVIHMLDYTFFRKHLFITFELMSLNLYELIKKNNYNGFSMSLI
RRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKFYTYIQS
RFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL
ISVARRRRLFFDSRDAPRCITNTKGRKRTPGSKSLAQILHCQDRYFIDFLQRCLEWDPAE
RMTPDEAAHHEFLQPSSSSRHRSCRMSNSSSSSGLNSVSQKSSCYNFADISPGSGTGGVV
GGGPVVASITSTTAVHNAAIATTTKSRQQQAQVQSQSHTHGHAQSNGHLPEIKLSASDKY
NSMQKVAVRSKITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLNGSGVSSKY
GSSTLAHNHHNVTHHNASTATIATATHHHHHHGGAGGGQQQQSSSGATVMSHSQSTGDVS
DRAIFGRA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgccgattcagctggacaacgacaagctgcgccgggatgct
cgcctctcgagctctcgactggacttgccccagctctgcaacggctccaggcgactggac
ggacacaacaatcatgtggctgtcaatgagacctcggccaatgccacgtccctgaacggc
aacagcaacgggaataccaacggtcacaacaacaataacaacaacatcggctccccagtc
tcctcatcgaccaccaacagtagcagcaacggggtcaacgagcggggctcctccacaaag
tccaacagcagcagtggcagctccggcaactcggccagcagcacaggcagcgccgaacca
aaatgcaacacccccatgacgccatctgaactggtgaaaaagttccggaactacctaaca
gacctggagttcgaggagctgaaggtgtacaaggaggtctggtactttggccagcatgcc
agcaagaactacaacaaacccgcccccacagccaataccactaacctgggctatgacgat
gacaatggcaactacaagatcatcgagcacgatcacgtagcctttcggtatgagattctg
gaggtgattggcaaaggcagcttcggccaggtgatccgggccctggaccacaaaaccaac
acacacgtggccatcaagataatcaggaacaagaagcgcttcctcaaccaggccgttgag
gagctcaacattctggacgagctgcgggacaaggatgcggatggatctcacaacgtcatc
cacatgctggactacacgtttttccgtaaacacttgttcatcaccttcgagctgatgagc
ctgaacctgtacgagttgataaagaagaacaactacaatggattcagcatgagtctcatt
cgccggttctgcaactcgattgtgaagtgcctgcgtctgctttacaaggaaaacatcatt
cactgtgatctcaagccagaaaatatcttgctcaaacagcgaggcagcagctcgatcaaa
gtcattgactttggcagctcgtgctacgtggaccgcaaattctatacgtacatccaatct
aggttctatcggtccccggaggtgattctcggactacaatacggcaccgccatcgacatg
tggagcttaggctgcatccttgccgagctttacacgggctttccccttttccccggcgag
aacgaggtggaacagctggcctgcatcatggaggtgctgggcctgccacccaaggtgctc
atttcggtagccaggaggcgccgactcttcttcgattcccgggatgctccgcgctgcatc
accaacaccaaaggcaggaagcggacaccgggcagcaagtcgctggcacagatcctgcac
tgccaggaccggtactttattgacttcctgcagcgctgccttgagtgggatcccgcggag
cggatgacgccggacgaggcagcccatcacgagtttctgcagccctcctcctccagtcgc
catcgcagctgccgcatgtcgaacagctcctccagctccggcctgaacagtgtctcccag
aagtcctcctgctacaattttgcagatatctcgccgggcagcggaaccggcggtgtcgtc
ggtggtggtcccgtggtggcttcgataaccagcaccacggcagtgcacaatgcggcaatc
gccaccacgaccaagtcaaggcagcagcaggcgcaggtgcagtcccagagccacacccat
ggccacgcccagtcgaacggacacctgccggagattaagttgagtgccagcgacaagtac
aacagcatgcagaaggtggcggtgcgctcaaagatcacgtccagcgtctcggacttggaa
tccgtgcagcagtactccctgcaccgcatctacgggggcgtgggaagcggcagtacccac
catgtctcctcggcggccaccaggaagcacctgaacggcagcggagtgtcctccaagtac
ggcagctcaactctggcgcacaatcaccacaatgtgactcaccacaatgcatccacggcc
accattgccaccgccacgcaccaccaccaccatcacggcggggcaggcggtgggcagcag
cagcaatcgtcgtcgggagccaccgtcatgtcacactcacagtcaaccggcgatgtctcc
gacagagccatcttcgggagagcttga

DBGET integrated database retrieval system