KEGG   Drosophila ananassae: Dana_GF15693Help
Entry
Dana_GF15693      CDS       T01059                                 

Definition
GF15693 gene product from transcript GF15693-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dan  Drosophila ananassae
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dana_GF15693
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dana_GF15693
Glycosyltransferases [BR:dan01003]
 Glycan extension
  Type 3 chain
   Dana_GF15693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 390 aa AA seqDB search
MHANSLLGRSILNEGRSNKRSFVSLIVGLVVGFCLAELFVYTSTPERSEFMPYDGHRHGD
VNDAHHSHDMMELTGPEQDVGTHEHVHENSTIAERLYGEVRILCWIMTNPSNHQKKARHV
KRTWGKRCNKLLFMSSEKDEELDAVALPVGEGRNNLWGKTKEAYKYIYKHHINDADWFLK
ADDDTYTIVENLRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEA
LPNPKVCKDENTGAEDVEMGKCLENVKVVAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKF
WYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPDALPNKLAV
GELMPPPKDQDTESSSDGGVSKRSTDTKPQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccaatagtctgttaggaaggtccatattaaatgaaggccgttcaaataaacgt
tcctttgtgtccttgatcgtgggcctggtcgtaggcttttgcctcgcagagctcttcgtg
tacacctccaccccggaacgtagcgagttcatgccctacgatggccaccggcatggcgat
gtcaacgacgcccaccacagccacgacatgatggagttgacggggccggaacaggatgta
ggcacccacgagcacgtccacgagaactcgaccatcgcagagcgactctacggcgaggtg
cgcatcctctgctggatcatgaccaatcccagtaaccaccagaagaaggcccggcatgtg
aagcgcacctggggcaagcggtgcaacaagctgctattcatgagctcggaaaaggatgag
gagctggacgcagtggccttgccggtgggcgagggccggaacaatctatggggcaagacg
aaagaggcgtacaagtatatctacaagcaccatatcaacgatgccgactggttcctcaag
gccgacgatgacacgtacacgatagtggagaacttgcgctacatgctgtacccgtacaac
ccagagactccggtgtactttggctgcaagttcaagccgtacgtgaaacagggctacatg
tccggcggtgccggctacgttctcagccgggaggctgtgcgtcgctttgtggtcgaggcc
ctgcccaatcccaaggtctgtaaagacgaaaacacgggcgccgaggacgtggagatgggc
aagtgcttggagaatgtgaaagtagtggccggggattcccgcgattccaacggacgtggt
cgcttctttccctttgttccggagcatcatctgattccatctcacacagacaagaagttc
tggtactggcaatacatattctacaaaaccgacgagggcctagactgctgctcagataat
gccatatccttccactacgtatcgccaaaccaaatgtacgttctggattacttgatttat
catttgagaccctacggcatcataaatacgccggatgccctgcccaacaaactggctgtg
ggcgaactaatgccaccacccaaggatcaagacacagagagctcgagcgacggcggagtc
tccaaaagatccacagacacaaaaccccaataa

DBGET integrated database retrieval system