KEGG   Drosophila ananassae: Dana_GF15745Help
Entry
Dana_GF15745      CDS       T01059                                 

Definition
GF15745 gene product from transcript GF15745-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dana_GF15745
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dana_GF15745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1020 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTQDSPVQIGLYIRREEKPLYSPIVTPSASEA
KLQRLRQQQPPPSGSSSSAYASAFASATATAVPFENGSANNGGQEKKFHSNMAREEDEDA
TTASVNGNAINVTRSNSKLKPVKERRPTALPSEVPSIEIEEDSPEDAKDTSQSGQEEERT
GGKGRANAHAVNVVDGGKSKLKVNVNGIIDERGGADDVATFDVATTPSTAAATPVTEGPV
KFFIGHTQDLNTHQTEDTLSWQSSDTNNNRNNDASNTSKLANGVLPLQRRDRDKEQLEAP
PRAKSSSNVSLNYLAKPPSNAGSPSRRRVSTMPDINIPPAPPMPPDLLVPVTPLHLRKKR
SMERPPQSQTQTQSPGIPPDASNNQDQITGPKESNSSDGSAAKTQRVDGGIIYVRPNVPI
RGDIEIEFIAKDEATRNLIRTAIERNDFLNNLMDKERKEMVINAMAPCCYKKHSFIIREH
EEGSEIYVSAEGQYDVIRAGQLVGNFGPATVFGELAILYNAPRQATIQAATDTHVWKISR
ETFRAIMQISGSREREENLQFLRSAPFLQELDQSLLHKVVDLLQRKFYETDTCIVRQGEV
GNEFYIIRCGTVTIKKKDEQGQELVVAKRRRGEYFGEQALLNADVRQASVYADAPGTEVL
MLDREAFISYLGTLKQLREKPSSQQGESSGRSSNKSLEFDNEYSQVAISELKKIATLGCG
AFGRVDLVAYGKKALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRNSPFIVQLYRTYRND
KYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHDFIYRDLKPENLM
LGTDGYCKLVDFGFAKFVRHNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILIYEL
LVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIA
DIKRHSWFESLDWQKLKQKQLQSPIKRPLKSWTDLQYFGPSGVENDYEPPEEMSGWDKDF
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccccgcttattccaccatcgaagcaaaaacaaattcacgcccgccgaa
gatgaaaacaccgatacgatactcaacacacaggatagccccgtgcaaattggcctctac
atccgtcgcgaggagaagccactgtactcgcccatcgtcacgcccagcgccagcgaggcc
aagctccagcggctgagacagcagcagccgcccccctcaggtagctcctcctctgcctac
gcctccgccttcgcctccgccacagccacagcggttcccttcgaaaatgggagtgcaaac
aatggaggccaagagaagaagtttcactcgaacatggccagggaagaggacgaggatgcg
acaacggcctctgtcaacggcaatgcaattaatgtcacacgctcaaattcgaaattaaaa
ccggtcaaagagcgacgtcccacagccctgccctcggaggtgccatccattgagatcgag
gaggattcgccggaggatgccaaggatacgtcgcagagcggccaggaggaggagcgaaca
ggaggcaaggggcgtgctaatgcacatgccgtcaatgtcgttgatggcggcaagtcaaaa
ctcaaagtgaatgtgaacggcataattgatgagaggggcggtgccgatgatgttgccaca
ttcgatgtcgccacaacgccaagcaccgccgccgcaacacctgtgaccgagggtcctgta
aagtttttcattggtcacacacaggacctaaacacacaccaaacagaggacactttgtcc
tggcagagcagcgataccaacaacaaccgcaacaacgatgccagcaataccagcaaactg
gcaaatggtgtcctgccgctgcagcgacgggatcgtgacaaagaacagctcgaggctcca
ccccgtgccaagagctccagcaatgtgtcactcaattatcttgccaagccaccaagcaat
gccggcagtcccagccgcagacgagtgtccacgatgcccgatattaacataccgccagca
ccaccgatgcccccggatcttctcgtcccggtaactccactccatttgcgcaagaaacgg
agcatggagcgtccccctcagtcgcagacccagacgcagtcacctggcattccgccggat
gcttcgaataatcaagatcaaataactgggcccaaggagagcaattccagcgatggctcg
gctgcgaaaacacaacgcgtggacggcggaatcatctacgttcgaccgaatgtgcccatt
cggggcgacattgaaatcgaatttattgcaaaggacgaggccacacgcaatctcatccgg
acggccatcgaacgcaatgatttcctcaataatctaatggacaaggagcgcaaggagatg
gtaatcaatgcaatggcgccgtgctgctacaaaaagcacagttttatcatccgcgagcac
gaggagggctccgagatatatgtttccgccgagggtcagtacgatgttatccgtgcgggt
caactggttggaaactttggtccggccactgtattcggagagctggcaattctctataat
gcccctcgccaggccaccatacaggctgccacggatacccacgtttggaaaatttcacgt
gaaacctttcgggccatcatgcaaatctccggctctagggagcgcgaggaaaatcttcag
tttctgcgctcggcgccgtttttacaggagcttgaccagagcctgctgcacaaggtcgtg
gatcttctgcaaaggaaattctacgagaccgacacttgtattgtgcggcaaggcgaggtg
ggcaacgagttctacatcatccggtgcggaactgtgactataaaaaagaaggacgagcag
ggccaggagcttgtggtggcaaaaaggcgaaggggcgagtacttcggagagcaggcactt
ttgaatgcggatgttcgacaggccagtgtttatgccgacgccccaggcacggaagtccta
atgctggacagagaagcctttataagctacttaggaactctgaagcaactccgggagaag
cctagcagccagcagggcgaatcatcgggaagatctagcaacaagtccttggagttcgac
aacgaatactcccaagtggccatttccgagctgaagaagattgcgaccctcggatgcgga
gcctttggacgcgtagacttggtggcgtatggaaaaaaggccttagccctgaagatcatc
aagaaaatcgaggtggtaaagcaggatcaaatcgagcacgtttacaacgagaagaatgtt
atgattaagtgccggaactcaccctttatagtgcagctctatcgcacgtaccggaatgac
aaatacgtttacttcctaatggaggcctgcatgggcggtgatgtatggacggtgatgtca
aagcggcagtatttcgatgagaagaccgccaaatttatagcgggctgtgttgtcgaggca
ttcgattatttgcactcccacgactttatttacagggacttgaagcccgagaatttaatg
ctgggcacggacgggtactgcaaattggtcgactttggctttgcaaaattcgtacgtcac
aatgagaaaaccaacacctttgccggcactccggaatatgtggctcccgagattatcctg
gatcgtggccatgatcgtgctgtcgactactgggctttaggtatcttgatctacgaactg
ctcgtcggaaaaacgccgttccggggagtcaaccagatcaagatctaccagcagatcctc
agcggcatcgatgtcatccacatgccttcgcggataccaaagtccgcacagcacctggtc
aggcatctctgcaagcagctaccggcggagagactgggctaccagaggaagggaatcgcg
gatattaagcggcacagctggttcgagagcttggactggcagaagctgaaacagaagcaa
ctgcaatcgcccatcaagcggcccctgaagagctggacggacctccagtacttcggccca
tctggagtggagaacgactacgagccgccggaggagatgagcgggtgggacaaagacttt
taa

DBGET integrated database retrieval system