KEGG   Drosophila ananassae: Dana_GF15745Help
Entry
Dana_GF15745      CDS       T01059                                 

Definition
(RefSeq) GF15745 gene product from transcript GF15745-RD (EC:2.7.11.-)
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
dan  Drosophila ananassae
Module
cGMP signaling
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dana_GF15745
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dana_GF15745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1041 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTQDSPVQIGLYIRREEKPLYSPIVTPSASEA
KLQRLRQQQPPPSGSSSSAYASAFASATATAVPFENGSANNGGQEKKFHSNMARLQKASR
AREIDREKDQEAQDREEDEDATTASVNGNAINVTRSNSKLKPVKERRPTALPSEVPSIEI
EEDSPEDAKDTSQSGQEEERTGGKGRANAHAVNVVDGGKSKLKVNVNGIIDERGGADDVA
TFDVATTPSTAAATPVTEGPVKFFIGHTQDLNTHQTEDTLSWQSSDTNNNRNNDASNTSK
LANGVLPLQRRDRDKEQLEAPPRAKSSSNVSLNYLAKPPSNAGSPSRRRVSTMPDINIPP
APPMPPDLLVPVTPLHLRKKRSMERPPQSQTQTQSPGIPPDASNNQDQITGPKESNSSDG
SAAKTQRVDGGIIYVRPNVPIRGDIEIEFIAKDEATRNLIRTAIERNDFLNNLMDKERKE
MVINAMAPCCYKKHSFIIREHEEGSEIYVSAEGQYDVIRAGQLVGNFGPATVFGELAILY
NAPRQATIQAATDTHVWKISRETFRAIMQISGSREREENLQFLRSAPFLQELDQSLLHKV
VDLLQRKFYETDTCIVRQGEVGNEFYIIRCGTVTIKKKDEQGQELVVAKRRRGEYFGEQA
LLNADVRQASVYADAPGTEVLMLDREAFISYLGTLKQLREKPSSQQGESSGRSSNKSLEF
DNEYSQVAISELKKIATLGCGAFGRVDLVAYGKKALALKIIKKIEVVKQDQIEHVYNEKN
VMIKCRNSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVE
AFDYLHSHDFIYRDLKPENLMLGTDGYCKLVDFGFAKFVRHNEKTNTFAGTPEYVAPEII
LDRGHDRAVDYWALGILIYELLVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHL
VRHLCKQLPAERLGYQRKGIADIKRHSWFESLDWQKLKQKQLQSPIKRPLKSWTDLQYFG
PSGVENDYEPPEEMSGWDKDF
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccccgcttattccaccatcgaagcaaaaacaaattcacgcccgccgaa
gatgaaaacaccgatacgatactcaacacacaggatagccccgtgcaaattggcctctac
atccgtcgcgaggagaagccactgtactcgcccatcgtcacgcccagcgccagcgaggcc
aagctccagcggctgagacagcagcagccgcccccctcaggtagctcctcctctgcctac
gcctccgccttcgcctccgccacagccacagcggttcccttcgaaaatgggagtgcaaac
aatggaggccaagagaagaagtttcactcgaacatggccaggttacagaaggccagcagg
gcgagggagatagatagagaaaaggaccaggaggcccaagatagggaagaggacgaggat
gcgacaacggcctctgtcaacggcaatgcaattaatgtcacacgctcaaattcgaaatta
aaaccggtcaaagagcgacgtcccacagccctgccctcggaggtgccatccattgagatc
gaggaggattcgccggaggatgccaaggatacgtcgcagagcggccaggaggaggagcga
acaggaggcaaggggcgtgctaatgcacatgccgtcaatgtcgttgatggcggcaagtca
aaactcaaagtgaatgtgaacggcataattgatgagaggggcggtgccgatgatgttgcc
acattcgatgtcgccacaacgccaagcaccgccgccgcaacacctgtgaccgagggtcct
gtaaagtttttcattggtcacacacaggacctaaacacacaccaaacagaggacactttg
tcctggcagagcagcgataccaacaacaaccgcaacaacgatgccagcaataccagcaaa
ctggcaaatggtgtcctgccgctgcagcgacgggatcgtgacaaagaacagctcgaggct
ccaccccgtgccaagagctccagcaatgtgtcactcaattatcttgccaagccaccaagc
aatgccggcagtcccagccgcagacgagtgtccacgatgcccgatattaacataccgcca
gcaccaccgatgcccccggatcttctcgtcccggtaactccactccatttgcgcaagaaa
cggagcatggagcgtccccctcagtcgcagacccagacgcagtcacctggcattccgccg
gatgcttcgaataatcaagatcaaataactgggcccaaggagagcaattccagcgatggc
tcggctgcgaaaacacaacgcgtggacggcggaatcatctacgttcgaccgaatgtgccc
attcggggcgacattgaaatcgaatttattgcaaaggacgaggccacacgcaatctcatc
cggacggccatcgaacgcaatgatttcctcaataatctaatggacaaggagcgcaaggag
atggtaatcaatgcaatggcgccgtgctgctacaaaaagcacagttttatcatccgcgag
cacgaggagggctccgagatatatgtttccgccgagggtcagtacgatgttatccgtgcg
ggtcaactggttggaaactttggtccggccactgtattcggagagctggcaattctctat
aatgcccctcgccaggccaccatacaggctgccacggatacccacgtttggaaaatttca
cgtgaaacctttcgggccatcatgcaaatctccggctctagggagcgcgaggaaaatctt
cagtttctgcgctcggcgccgtttttacaggagcttgaccagagcctgctgcacaaggtc
gtggatcttctgcaaaggaaattctacgagaccgacacttgtattgtgcggcaaggcgag
gtgggcaacgagttctacatcatccggtgcggaactgtgactataaaaaagaaggacgag
cagggccaggagcttgtggtggcaaaaaggcgaaggggcgagtacttcggagagcaggca
cttttgaatgcggatgttcgacaggccagtgtttatgccgacgccccaggcacggaagtc
ctaatgctggacagagaagcctttataagctacttaggaactctgaagcaactccgggag
aagcctagcagccagcagggcgaatcatcgggaagatctagcaacaagtccttggagttc
gacaacgaatactcccaagtggccatttccgagctgaagaagattgcgaccctcggatgc
ggagcctttggacgcgtagacttggtggcgtatggaaaaaaggccttagccctgaagatc
atcaagaaaatcgaggtggtaaagcaggatcaaatcgagcacgtttacaacgagaagaat
gttatgattaagtgccggaactcaccctttatagtgcagctctatcgcacgtaccggaat
gacaaatacgtttacttcctaatggaggcctgcatgggcggtgatgtatggacggtgatg
tcaaagcggcagtatttcgatgagaagaccgccaaatttatagcgggctgtgttgtcgag
gcattcgattatttgcactcccacgactttatttacagggacttgaagcccgagaattta
atgctgggcacggacgggtactgcaaattggtcgactttggctttgcaaaattcgtacgt
cacaatgagaaaaccaacacctttgccggcactccggaatatgtggctcccgagattatc
ctggatcgtggccatgatcgtgctgtcgactactgggctttaggtatcttgatctacgaa
ctgctcgtcggaaaaacgccgttccggggagtcaaccagatcaagatctaccagcagatc
ctcagcggcatcgatgtcatccacatgccttcgcggataccaaagtccgcacagcacctg
gtcaggcatctctgcaagcagctaccggcggagagactgggctaccagaggaagggaatc
gcggatattaagcggcacagctggttcgagagcttggactggcagaagctgaaacagaag
caactgcaatcgcccatcaagcggcccctgaagagctggacggacctccagtacttcggc
ccatctggagtggagaacgactacgagccgccggaggagatgagcgggtgggacaaagac
ttttaa

DBGET integrated database retrieval system