KEGG   Drosophila ananassae: Dana_GF15859Help
Entry
Dana_GF15859      CDS       T01059                                 

Definition
GF15859 gene product from transcript GF15859-RA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF15859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 815 aa AA seqDB search
MPVESGSSSSESGSSSSSGSSSCTDTGSSSDTDSSSATPEEKPTQNPSTKTQPQSHQQQT
NSGNAARRKAPPASTSANEEKSKESDDLLGLREIAVYPVGYSLTDDDDEDEPSAPPAKKT
SRTLGSSTVTAAAAASAARRKPPANKATGNQTNKANNPPQRTAGNTNRNHANGEGKRPSL
SSSSNSTDDSMKIVKNGRKVPLKMASTVKPKQQVRGKLPPAKKNGGPPLMSSSSGSESGS
NSGDESSSVSDSEGSDSSNSYSSQPPKGAAKGKKPGPSKLQNTDSEEERKDKANPMRKLT
RSLSMRRSKQQPKLESDTDSDGDLDDDKTLISKSPTKKPAVPSLNSTKSKVKKESIGISS
GVLSVIKSRPVSPITQTEKKCPIEGCDSSGHLSGNLDRHFLPEACPIYHNMSASECKERA
NERKLRNEQRLKMPVNIVTAPGNQHNNAKTLSPEQREFLNKIRESRANFRPANNNFLDSK
VKLEKDCTDEDREPNLSGLVPDYDLQLFREAQAQASERIEDELKDLPVGKGIKYISMGKY
KMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAQKCVWRHPPGDEIYRKGKLQ
VWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIP
FLQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRS
YWKDVLLDYLCNRSGNSLCIKDVSQEMAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVL
DEYEERVKRRGTFPKIDDSCLRWQPFIPVQPTASP
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtggaatccggcagtagcagctccgaatcggggagctcctcctccagcggatcc
agcagttgcacggacaccggcagcagctcggatacggattccagcagtgcgacgccggag
gagaagccaacccagaacccatccaccaaaacacaaccccaatcgcaccaacaacaaacc
aattccggcaatgctgcccggcggaaggctccaccggcctcgacatcagccaacgaggag
aaatccaaggaaagtgacgaccttctaggtctccgggaaatagcagtctacccagtggga
tactccctaaccgacgacgatgatgaggacgaaccatcggcgccgcccgccaagaagacc
tctcgcaccctcggcagttccacggtgacggcagcagctgcagcatcagcggccaggaga
aaaccgcctgcaaacaaggccactgggaatcagaccaacaaagccaataatccgccgcaa
cggacggcgggaaacacaaatcgaaatcatgccaatggcgagggaaagaggccctcgctt
tcatcctcttcgaatagcacagacgactccatgaagatcgtgaagaatggtcgcaaggtt
cccctgaaaatggccagcactgtcaagccaaaacagcaggttcgtggaaagctcccgccg
gccaagaagaacggaggaccaccgctgatgagcagtagctccggctcagagagcggttcc
aactctggggacgagtcgagttcggtgagtgactcagagggcagtgattccagcaattcc
tacagttcccagccacccaaaggggctgctaaaggaaaaaaacctggtccttccaagctc
cagaacactgacagcgaggaggagcgcaaagacaaagccaatcccatgaggaagctcacc
agatccctaagcatgcggagatcgaagcagcaacccaaactggaatcggataccgattcc
gatggcgatctggacgacgacaaaacactgatctcgaaaagtccaaccaagaaaccagca
gtcccgagtctgaacagcaccaagagcaaggtgaagaaggagtccatcgggatcagcagt
ggcgtcctgagcgtcatcaagtcccggccagtgtcgcccataacacaaacggaaaagaag
tgtcccatcgagggctgtgactcgtccggtcatttgagtggcaatctggacagacacttc
ttgccggaagcatgtcccatttaccacaacatgtccgcctcggagtgcaaggagagggcc
aacgaacggaagctgcggaacgagcagcgcctcaagatgcccgtgaatattgttacggct
ccgggaaaccagcacaacaatgccaagaccctgtcacccgagcagagggagttcctaaac
aaaatacgcgaatcgagagccaactttcggccggcaaacaataatttcctggactcgaag
gttaagctggaaaaagactgcacggatgaggaccgtgaaccgaatctgtcgggcctggtg
cccgactacgatctgcaattgttcagggaggcccaggcccaggcctccgagagaatagag
gacgaactgaaggatctcccggtgggcaagggcatcaagtacatcagcatgggcaagtac
aagatgaaggtatggtaccaatcgccctatccggatgacgccgcccgcctccccaagatg
tatatctgcgagttctgcctgcgctatcagaaatccgagacgggcatcaaacggcacgcc
cagaaatgcgtttggcggcatccgccaggtgatgagatctacaggaagggcaagctccaa
gtgtggcaggtggatgggaagcgttataagcaatactgtcagcatctctgcctcctggcg
aagttctttctggaccacaagactctgtactacgatgtggagccgtttcttttctacatt
atgacactggcggatgtggatggatgccatattgtgggttactttagtaagcatattccc
tttcttcaggagaagaattctttttacaatgtctcctgtattttgacattgccgccatat
cagaggaagggctacgggaggcttctcatcgactttagctatttactgacacgcgtagag
ggcaaaatcggatctccggagaagcctctgtccgatctgggactcatctcgtaccgctcc
tactggaaggatgtccttttagactatctgtgcaatagatcgggaaactcgctatgcatc
aaggacgtctcacaagaaatggccatatactcttatgatatagtcagcactctccaagcc
cttggaatgatgaaatattggaagggaaagcacatagtccttaaaaaacaggatgtcctt
gacgagtatgaggagagggttaaaagaagaggaaccttcccgaagatcgacgattcttgc
ctcagatggcagccatttatccccgtacagcccacggcatcgccatag

DBGET integrated database retrieval system