KEGG   Drosophila ananassae: Dana_GF15860Help
Entry
Dana_GF15860      CDS       T01059                                 

Definition
GF15860 gene product from transcript GF15860-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dana_GF15860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF15860
   00020 Citrate cycle (TCA cycle)
    Dana_GF15860
   00620 Pyruvate metabolism
    Dana_GF15860
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dana_GF15860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MLRSLANTRNEFGALRSVLLRSNTVSSGRRSGASLGVRALSCQLNNSRNLHSIRSNLTPP
KPLTAWSYNFARAYASLPEHMRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGYLAKILIPGGTKDVPVGKLLCIIVPDQGSVAAFKDFKDDGPAPAAAAP
PPAAPAAAPAPAAAPAPAPAAAPAPAAPAPAPAAAPAAAGTGRVYASPMAKKLAEAQQLR
LQGKGSGVHGSIKSGDLAAQKSGAKAAAAAPAGPAPPAPAGARYQDIPVTNMRAIIAKRL
LESKTQLPHYYVTVQCQVDKLMKFRAQVNKKYEKKGVRVSVNDFIIKATAIASLKVPEAN
SAWMGQVIRQYDDVDVSVAVSTDKGLITPIVFNADRKGVIEISKNVKELAGKARENKLKP
QEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVADPDSPKGFKEVNLLTV
TLSADHRVVDGAVAARWLQHFRDYMEDPASMIL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgatctctggcgaatacacgaaacgaattcggagccctgcgctctgtgctcctc
cgatcgaataccgttagctccggccgcagatccggcgccagcttgggcgtccgtgctctt
agctgccagctgaacaattcccggaatctccatagtatcaggtctaatcttaccccgcca
aagcccctgacagcatggagctacaactttgcccgcgcctacgccagcctgccagagcac
atgagggtgccactgcccgccctctcacccaccatggagcgcggttcgattgtcagctgg
gagaaaaaggaaggcgacaaactcaacgaaggtgacttgctgtgcgaaatcgagacggac
aaggccaccatgggctttgagactcccgaagagggttacctggccaagattctcatccct
ggcggcaccaaggacgttcccgttggcaagctcctgtgcatcatcgttcccgatcagggc
agtgtagccgccttcaaagattttaaggatgatggacctgctcctgccgccgctgcccca
cctccagctgctccggcagcagctcctgcaccagcagcggcaccggctccagccccagct
gctgctccagcacccgccgcaccagcacccgctccagccgctgccccagctgcagcaggt
acgggccgcgtgtacgccagtccgatggccaagaaactagccgaggcacaacagctgcgt
ctacaaggcaagggcagtggagtccatggctcaattaaatctggtgatcttgcagcccag
aaatcgggggccaaggccgctgctgccgctcctgcaggccccgctcctccagcaccagca
ggagctcgctaccaggacatcccggtgaccaacatgagggccatcatcgccaagcgcttg
ctggagtccaagacacaactgcctcattactacgtcaccgttcaatgtcaagtagataag
ttgatgaagttccgggctcaggtcaacaagaagtacgagaagaagggtgtccgtgtctcc
gtaaacgacttcattatcaaggccactgccatcgccagtcttaaggtgcccgaggccaac
tccgcatggatgggccaagtgatccggcagtacgatgacgtggatgtctcggtggctgtc
tccacggacaagggtctcatcacaccgattgtcttcaatgccgaccgcaagggcgtcatt
gagatttccaagaatgtcaaggagctggccggcaaggcccgggagaacaagctgaagcca
caggagttccagggcggcactatctcggtgtctaatctgggaatgttcggtgttaatcag
ttctgtgccgtaattaatcccccgcaatcgtgcatcctggccattggaaccacaacgaaa
cagctggttgccgatcccgacagtccaaagggcttcaaggaggtcaacctactgaccgtc
accctcagcgctgaccatcgggtagtggacggcgccgtggctgccaggtggctgcaacac
ttccgggactacatggaggatccagcttcaatgatactctaa

DBGET integrated database retrieval system