KEGG   Drosophila ananassae: Dana_GF16041Help
Entry
Dana_GF16041      CDS       T01059                                 

Definition
GF16041 gene product from transcript GF16041-RA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 226 aa AA seqDB search
MAWRSVGTSNQDLIRQLKENGVIASEAVADAMAATDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDHLKPGAHVLDVGSGSGYLTACFYRYIKAKGTNPDTRIVGIEHQADL
VNMSKANLNADDREILNSGHFEIVQGDGRKGYPSRAPYNAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPDGGSQYMQQYDKDSNGKVQMTRLMGVMYVPLTDLRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcgctctgtaggaacgagcaaccaggatctcatcaggcaactgaaggagaac
ggcgtaattgcaagcgaggcagtggccgatgccatggcagcgacggaccgcaagcattat
tctcctcggaacccctatatggatgctccccagcctattggcggaggtgtcaccatcagt
gctccccacatgcatgcttttgcgttggaatatctacgcgatcaccttaagcccggtgcc
cacgtcctggacgttggctctggatcgggatacctaacagcttgcttctaccgctacatc
aaggcgaagggaacgaatccggatactcgaattgtgggtatagaacaccaggctgatttg
gtgaacatgagcaaggccaatctgaacgctgacgatcgcgagattctcaactccggccat
tttgagattgtacagggtgacgggcgcaagggataccccagtagggccccctacaatgcc
attcacgtgggcgcagctgctccggacacccccactgagctgatcaaccagctggctaac
ggcggccgtctcattgtgcccgtgggtcccgacggtgggtcacagtacatgcaacagtac
gacaaggactctaatggcaaggtacagatgacccgactcatgggcgtgatgtacgtgccc
ctaacggatctccggtcctga

DBGET integrated database retrieval system